KEGG   Takifugu rubripes (torafugu): 101068642Help
Entry
101068642         CDS       T02386                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101068642
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101068642
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101068642
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101068642
  Exosomal proteins of breast milk
   101068642
Heparan sulfate/heparin binding proteins [BR:tru00536]
 Enzymes (General comment) Variety
  101068642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 509 aa AA seqDB search
MKAWKSGVVFILVLNAAVCHVTTLEGELADSISGNFLDPIKDLLNDRDDSNQTVARFSLR
KPSHPDADQCYIVPGRADTLAACTFNRTSKTFMVIHGWTLSGMFESWVSKLVSALYEREH
GANVIVVDWLTLAQNHYVLAAQKTKAVGQEIARFIDWIEESTNAPAENIHLIGYSLGAHV
AGFAGSHMTNKVGRITGLDPAGPDFEGMHAHRRLSPDDAHFVDVLHTFTRGSLGLSIGIQ
QPVGHVDIYPNGGSFQPGCNLRGTLEKIANFGIFAITDAVKCEHERSVHLFIDSLLNEQD
AAQAYRCSSSQTFNRGMCLSCRKSRCNTVGYDISKVRKARNVQMYTKTRATMPFRVYHYQ
LKIHFSSKVNRSEMEPSLTVSLYGTKGEAENLELKLKEKIAVNKTHSFLLVTEKDVGDLL
MLTFKWEETNSWSSSRLLKMVSSWWGGDSGGADVQVHKIRVRAGETQQKMVFCVKNPDVQ
NLMREVTFVRCKDAWRTSGKRVTLENHRP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtggaaaagtggggttgtgttcatcctggtattgaatgcagctgtgtgtcat
gtgacgaccctggaaggagagctcgctgattctatttctggcaacttcctggacccaatc
aaagacttgctcaacgacagggatgacagcaaccaaactgttgccagattctccctccgg
aaaccttcccatccagacgctgaccagtgctacatcgttcctggcagagctgacaccctg
gccgcctgcaccttcaaccgcacctccaaaaccttcatggttatccacggatggacgctg
agcggcatgttcgagagctgggtgtcgaagctggtgtcggcgctttatgagagggagcac
ggcgccaacgtcatcgtggtggactggctcacgttggcgcagaaccactacgtgctggca
gctcagaaaaccaaagcggtggggcaggagatcgctcgcttcatcgactggattgaggaa
tccaccaatgccccagctgagaacatccatctgattggctacagcctcggtgctcatgtg
gcgggatttgccggcagccacatgaccaataaagttgggaggataactggtctggatccg
gctggcccagactttgaggggatgcacgcacacagacgcctctcgccggacgatgctcac
ttcgtggacgtgctccacaccttcacacggggctccctgggtctcagcatcgggatccag
cagcctgtcggtcatgtcgacatttaccccaacggaggcagcttccagccaggctgcaac
ctcaggggcactctggagaagatcgctaactttgggatatttgccatcaccgacgccgtg
aagtgcgaacacgagcgctccgtccacctcttcatcgactccctactgaatgagcaggat
gcggcccaggcctaccggtgcagcagcagccaaacatttaaccgcggaatgtgcctcagt
tgccgcaagagccgctgcaacacggtgggctacgacatcagcaaagtccgcaaggcgcgc
aacgttcagatgtacaccaagacgcgagcgaccatgcctttcagagtttatcactatcag
ctgaagatccacttttccagtaaagtgaaccgctcggagatggagccctcgctcaccgtc
tccctgtatgggaccaaaggagaggccgaaaacctggagctcaaactgaaggagaaaatc
gcagtaaataaaacacattccttcctgctggtgacggagaaagacgtcggggatctgctg
atgctgacgttcaaatgggaggaaacaaacagttggtcctcctccaggttgctgaaaatg
gtgtcgtcttggtgggggggcgactcgggcggcgccgacgtgcaggttcacaagatccgc
gttcgagccggagagacccagcagaagatggtgttctgtgtaaaaaaccccgacgttcag
aatttaatgcgggaggtcacatttgttagatgcaaggatgcctggaggacatctgggaaa
agagtcactctggagaaccacaggccttga

DBGET integrated database retrieval system