KEGG   Takifugu rubripes (torafugu): 101068728Help
Entry
101068728         CDS       T02386                                 

Definition
histone-lysine N-methyltransferase EZH2-like
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 760 aa AA seqDB search
MVLTGKRSEKGPACWKRRVKSEYMRLRQLKRFRRADEIKSMFSTNRQKIVERTDILNQEW
KTRRIQPVHIMTSVGSLRGTRECTVDSSFSEFPRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALA
QYSDNEDDEEEEEHDYKVDKLELCDSKERPEDTRKDVLATSESRTGADGKKFPSEKIFEA
ISAMFPDKGSTEELKEKYKELTEQQLPGALPPECTPNIDGPNARSVQREQSLHSFHTLFC
RRCFKYDCFLHPFHATPNTYKRKNLENLVDSKPCGLDCYMYLLQDGIASEYPAGGLAERA
KTPSKRAVGRRRGRQPNSNSRPSTPTVSSETKDADSDREGSKDDERENDKDDDYKKDENT
SSSEGNSRCQTPVKMKLSGEAEAVEWNGAEASLFRVLIGTYYDNFCAIARLIGTKTCRQV
YEFRVKESSIIARAPAEDEDTPPRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHP
RQPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCL
TCGAADHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNDFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDH
RIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacagggaagcgctcggagaaaggacctgcctgctggaaaaggagggtgaag
tccgagtacatgaggcttcgccagctcaaacgcttcagacgggccgatgaaatcaagagc
atgttcagcaccaaccggcaaaagatcgtggagcgaactgatatcttgaaccaggagtgg
aagaccaggcgaatccagccagttcacatcatgacatccgtgggctcgttgagaggcacc
cgggagtgtacggtggacagcagcttctcggagttccccaggcaggttatccccctgaag
accctgaacgctgtggcttcagtcccagtcatgtactcctggtcgcccctgcagcagaac
ttcatggtagaggatgagacggtgcttcataatattccctacatgggagacgagatcctg
gaccaagacggtactttcatcgaagagctgataaagaactatgatgggaaagtgcacgga
gacagagaatgtggcttcatcaacgatgagatatttgtggagctggtgaacgctctggcc
cagtacagtgacaacgaagatgacgaagaggaggaagaacacgactataaggtggacaag
ctggagttgtgtgacagtaaggagcgtccagaggacacccgcaaggacgtgctcgccacc
agcgagagccgcaccggcgctgacggcaagaagtttccttctgagaagatctttgaggcc
atttctgccatgttccccgacaaaggctcaaccgaggagctcaaagagaagtacaaggag
ctgacggagcagcagctgcccggtgcgctgccccccgagtgcacgcccaacatcgacggt
ccaaacgcccggtccgtgcagcgcgagcagagcctgcactccttccacacgctgttctgc
aggcgctgcttcaaatacgactgcttcctccacccttttcacgcaacccccaacacctac
aagcgcaagaacctggagaacctggtggacagtaaaccctgtggcctcgactgctacatg
tacctgctacaggacgggatcgccagcgagtatccagccgggggcctcgccgagcgggcc
aagaccccgtcgaagcgcgcggtcggccgtcgccgcggacgacagccgaacagcaacagc
cggcccagcacgcccaccgtctcctcggaaaccaaagacgccgacagcgaccgcgagggc
agcaaggacgacgagcgagaaaacgacaaagacgacgactacaagaaggacgagaacacc
agcagctcagaggggaactcgcggtgtcagactcccgtgaagatgaagctgagcggcgag
gctgaagcggtggagtggaacggagcagaagcctccctgttcagggttctgatcggcacc
tactacgacaacttctgcgccatcgcgcggctcatcggaaccaagacctgcagacaggtt
tacgagttccgggtcaaagagtcgagcatcatcgctcgggcgcctgctgaggacgaagac
actcccccgaggaagaagaagaggaaacaccggctctgggccacacactgccgcaaaatc
cagctgaagaaagacggctcctccaaccacgtgtacaactaccagccctgcgaccacccc
cggcagccctgcgactcctcctgcccctgcgtcaccgcccagaacttctgcgagaagttc
tgccagtgcagctccgaatgtcagaaccgcttccccgggtgccggtgcaaagcccagtgc
aacaccaagcagtgtccctgctacctggccgtgagggagtgcgacccggacctgtgcctg
acctgcggcgctgcggaccactgggacagcaagaacgtgtcctgcaagaactgctccatc
cagagaggagccaagaagcacctgctgctggcgccgtccgacgtggcgggatggggaatc
ttcatcaaagagccggtccagaagaacgacttcatctccgagtactgcggagagatcatc
tctcaggatgaagcggaccgcagggggaaggtttatgacaaatacatgtgcagcttcctg
tttaacctcaacaacgactttgtcgtcgacgcaacgaggaaaggcaacaagatccgcttc
gccaaccactccgtcaaccccaactgctacgctaaagtgatgatggtgaacggagatcac
aggataggaatctttgccaagagagccattcagacgggcgaggaactgttcttcgactac
aggtacagtcaggctgacgccctgaagtacgttgggattgagcgtgagatggagatcgcc
tga

DBGET integrated database retrieval system