KEGG   Takifugu rubripes (torafugu): 101068761Help
Entry
101068761         CDS       T02386                                 

Definition
eukaryotic translation initiation factor 3 subunit J-A-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101068761
Translation factors [BR:tru03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    101068761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 227 aa AA seqDB search
MADWDADTYEPKEPLKKATTMDKWEGEDEDEDIKDNWDDEDEDEEKKAEMTKTEPKVSEK
KKLMEKIKEKEERLKKKQEELKKNLEDELQEEELSLEEQLAEKLRVKKLQEESDLELTKD
AFGVGGTSNTVTGIDAMCPSSKEEFNEFERLLKEKFCQFEKSVHYSNFLESLFRELCISL
EVDDLKKVSNSLSVLLSEKQKQEKLPPVDDQYRLHQQLPNPEDHPAR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcggactgggacgctgacacctacgagccgaaggagccgcttaaaaaggcgacaacg
atggacaagtgggaaggcgaagacgaagacgaagatattaaggacaactgggacgatgag
gatgaagatgaagagaaaaaagcagagatgaccaaaacagagcccaaagtctctgaaaag
aagaagttgatggagaagatcaaagaaaaagaagaaagactaaagaagaaacaagaggag
ctgaagaagaacttggaggatgaattgcaggaggaagagctcagcctggaggaacagctc
gcggagaagctgagggtgaaaaagctacaggaggaatcggatttggagctgacaaaagat
gcttttggcgtgggcggcacctccaacaccgtgacgggcatcgacgccatgtgtccatcc
tccaaagaagagttcaacgagtttgagaggttgctaaaagaaaagttttgccagttcgaa
aagtcggtgcattattcaaatttcctggagtcgttgtttcgggaactctgcatttcatta
gaagtagacgacttgaagaaggtcagcaattccctctcagttctactaagtgaaaagcag
aaacaagaaaaactcccacctgtggatgaccagtacaggctccaccagcagttgccaaat
ccagaagatcatccagctcgttag

DBGET integrated database retrieval system