KEGG   Takifugu rubripes (torafugu): 101069055Help
Entry
101069055         CDS       T02386                                 

Gene name
aox1
Definition
(RefSeq) aldehyde oxidase 1 (EC:1.2.3.1)
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101069055 (aox1)
   00350 Tyrosine metabolism
    101069055 (aox1)
   00380 Tryptophan metabolism
    101069055 (aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101069055 (aox1)
   00760 Nicotinate and nicotinamide metabolism
    101069055 (aox1)
   00830 Retinol metabolism
    101069055 (aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101069055 (aox1)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101069055 (aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1341 aa AA seqDB search
MSTQKQGDTLCFFVNGKKVTENHADPETMLLSFLRQKLRLTGTKYGCGGGGCGACTVMLS
RYQPATKTITIRHLSANACLLPICQLHGAAVTTVEGIGSTKTRLHPVQERIAKSHGSQCG
FCTPGMVMSIYTLLRNKPKPSMEDITQALAGNLCRCTGYRPIIDGCRTFCQEAKCCGADG
NGNCCLNGEEKVLELEPPRLFDENDFLPLDPTQELIFPPELILMAETSNPKTLSFFGERV
TWVSTATLEDLVQLKSMNPKAPLIMGNTNIGPDMKFKGVFHPLIVSPTRVLELFEVNQTH
DGVWVGAGCSLSELQSLLASLVLKFPDEKTELFRALIQQLGNLGNQQIRNVASLGGNIVS
AYPNSDLNPLLAAGSSKVSVISKRGCRMVPLNQDFFVSFGKTVLKPEEVVVSVFIPFSKK
GEFVRAFRHAPRKEGSFATVTTGMRVLFAEGSNVVRDISIYYGGMGATIVSAAKTCSIIT
MRPWNDETLNKAYNVLLEELDLPPSAPGGKVEFRRSLTLSFLFRFNLEVLQKFRVSHQVL
PFFPPQNITDKIPEKIEPLPKEIDSGLQEFQPVSEDQNLQDPVGRPLMHRSAISQATGEA
VYCDDLPMTDGELFMVLVTSSRAHAKITGMDVSEALRLPGVADVITAADIPGQKVRMLFG
YEEELLADRQVSCIGQMLCAVVADTREHAKRGAAAVKISYEDLPDPIFTIEEAVARSSFF
EPQRRLERGNVDEAFNAAEHLYEGGIQTGGQEHFYMETQSILVIPAGEEMEYKVYASSQW
PALVQTAVAETLNIPSNRVSCHVKRIGGAFGGKVTKTSILACITSVAACKTGRAVRCVLE
RGEDMLITGARHPVQGKYKVGFMNDGTILGADFQFYANAGNTVDESLWVAEKMVLLLDNI
YNIPNLRGRAAACRTNLPSNTAFRGFGVPQGLLVVENMLNDVAMVLGCPADKIREVNMYK
GESVTLCKFKFNAENVRRCWDDCKSKSDYDNRRSAVDQFNRQNRWKKRGMSIIPIKYGIG
FSESSLNQAAALVHIYKDGSVLVTHGGAEMGQGLHTKVQQVASRELHIPLSKIYISETST
TTVPNTCSSAASFGTDANGMAVKDACQTLYQRLEPIRQKNPKGSWESWISEAYLEKVSLS
ATGFFRGQDLYIDWEKMEGNPFAYFTYGVCCCEVELDCLSGDYRTLGADIVMDIGRSVNP
SVDIGQIEGGFMQGLGLYTLEELKFSPSGLLYTRGPSQYKIPAVCDVPLRFNVYLLPDSH
NPHAIYSSKGIGEPTVFLGSSVFFAIKDAVAAARSESGLVGPFSLDSPAIPERVCLACVS
PFTQMIPINKPGSFKPWAINI
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcagaagcaaggagatactttgtgcttttttgtcaacggaaaaaaggttaca
gagaaccatgctgaccctgaaaccatgctgctctccttcctcagacagaaactgaggcta
acggggaccaagtatggctgcggaggcggaggctgcggcgcgtgcacggtcatgctgtca
cgctatcaacctgcgaccaaaaccatcaccattagacacctttccgccaacgcctgcctc
ctgccaatctgccagcttcacggagccgctgtgaccacggtggagggcatcggcagcacc
aagaccaggctccacccagtgcaggagcgaatagccaagtctcacggctcccagtgtggc
ttctgcacgcccgggatggtgatgtccatttacactctgctgaggaacaagcccaaaccc
agcatggaggacatcacgcaggcgttggctggtaatttgtgccgttgtactggatatcga
cccatcatcgatggctgcaggacgttctgtcaggaagctaagtgctgtggagccgacggg
aatggaaattgttgcctgaatggagaagagaaggttctagagctggaaccgccccgcttg
tttgacgagaatgactttttgcctttggacccgacgcaggagctcatcttcccaccagaa
ctaattttgatggcagaaacatcgaacccaaagactctgagcttctttggggagagggtg
acctgggtgtctactgccaccctggaggatctggtccagcttaagtccatgaacccaaaa
gccccactgatcatgggaaacaccaacataggtcccgatatgaagttcaaaggcgttttt
caccctctgattgtatctccaaccagagttctggaactgtttgaggtcaatcagacccat
gacggtgtttgggtcggagcaggatgtagtctgtctgagctgcagtctctcttggccagt
ctggttctaaagtttccagatgagaagacggaactcttcagagctttgatccagcagttg
gggaacctgggaaaccagcagatccgaaacgttgcttctcttggaggaaacattgtgagt
gcatatccaaactcagacctgaacccacttttggctgctggaagcagcaaagttagcgtt
atttcaaagagaggatgccgcatggttccgctgaaccaggatttctttgtgagttttggg
aaaactgtcctgaagcctgaggaggttgttgtctctgtctttattcccttctccaaaaag
ggggagtttgttcgagctttccgacacgctccgaggaaggagggctcttttgccaccgtg
accactgggatgagagtgcttttcgcagagggatcaaatgtggttcgtgacatcagtatc
tactacggaggaatgggagcgaccattgttagcgccgccaagacctgctctataattacg
atgaggccttggaatgatgagaccctcaataaggcctacaacgtcctcctggaggagttg
gacctccctccgtcagcccctggaggaaaggttgagttccgtcgctccttgactctcagc
ttcctcttcagattcaacctggaggtcctgcagaagttcagagtatctcaccaagttctt
cctttttttcccccccagaacattacagacaaaattcctgagaagatcgagcctctgccc
aaagagatcgactccggcctgcaggagttccagcctgtgtcagaagaccagaacttgcag
gacccggtgggacgtcccctcatgcatcgctctgccatcagccaggccacaggcgaggcc
gtgtactgcgacgacctccccatgacagacggggagctcttcatggttctggtcaccagc
tccagagcacatgctaaaatcacgggaatggacgtgagcgaggccctgcggctcccaggg
gtggccgacgtcatcactgcagccgacatccccgggcagaaggtccgcatgctgtttgga
tatgaggaagagctcctggccgatcgtcaggtgtcttgcattggccaaatgttgtgcgct
gtggtcgctgatacgagggagcacgccaaacgaggagcggcggctgtgaagatcagctat
gaagacctgccagatcccatttttacaatagaggaagctgtagccaggtcgtccttcttt
gagcctcagaggaggctcgagaggggtaacgtggatgaagcttttaacgccgctgagcac
ctgtatgaaggaggaatccaaacaggaggccaggaacatttctacatggagacccagagc
atactagtcattcctgctggtgaggaaatggagtataaggtttacgcttcctctcagtgg
ccagcgttagttcagactgcagtcgcggagacgctgaacatcccgtccaacagagtctcc
tgtcacgtcaaaaggatcggaggcgcttttggtgggaaggtcaccaaaacctcaatcctg
gcctgcatcacatccgtggcagcctgcaaaaccggacgcgcggtgcgctgtgtcctggag
cgaggcgaggacatgctgatcacaggagctcgccatcctgttcagggaaaatacaaggtg
ggtttcatgaatgacggaacgatcttgggcgcagatttccagttctacgccaacgctggg
aacaccgtggatgaatccttatgggttgcagaaaagatggtgcttcttctcgacaatatc
tacaacatccccaacctgcggggccgtgctgctgcctgcagaaccaacctgccctccaac
accgccttcaggggctttggtgtgccccaaggacttctggtggtggagaacatgttgaat
gatgttgccatggttctgggatgtcctgcagacaagattcgggaggtcaacatgtacaaa
ggtgagtccgtcacgctctgcaaattcaagttcaacgcggagaacgtgcggcgctgctgg
gacgactgcaagagcaaatccgactacgacaaccgccgctcggccgtggaccagtttaac
aggcagaaccggtggaagaagcggggcatgtccatcatccccatcaaatacgggatcggt
ttcagcgagagcagcctgaaccaggcggcggcgctggtccatatttacaaagacggttct
gttctggtcactcacggaggggcggagatgggtcagggacttcacaccaaagtgcaacag
gtggcgagtcgggagcttcatatcccgctgtcaaagatctacatcagcgaaacgagcacc
accactgttcccaacacctgctcttccgctgcgtccttcgggaccgatgccaacggcatg
gcggtcaaggatgcctgccagactttgtaccaacgactggagccaatcaggcagaagaac
cccaaaggatcatgggagagttggatcagtgaagcgtacttggagaaagtcagtttatca
gccacagggttcttcaggggtcaggatctttacattgactgggagaagatggagggcaat
cctttcgcgtacttcacatacggagtctgctgctgtgaggtggagctggactgcctctcc
ggagactacaggacactgggggctgacatcgtgatggacatcgggagaagcgtgaatccg
tctgtggacatcggccagatcgaaggagggttcatgcagggtttgggtctctacactctt
gaggagctcaagttttccccctctggtcttctctacactcgggggccgtctcagtataag
atccctgccgtctgcgacgtgccgcttcgcttcaatgtctatctgctgcctgactcccac
aaccctcacgccatctactcatccaagggcattggagaacccaccgtctttctgggcagc
tctgtgttcttcgccatcaaagacgccgtggcggctgcccgctctgagtccgggttggtc
ggcccgttttccctggacagccctgcgattccagagagggtctgcctggcctgcgtctcg
ccgttcactcagatgattcccattaacaaaccaggatctttcaaaccgtgggctataaac
atctaa

DBGET integrated database retrieval system