KEGG   Takifugu rubripes (torafugu): 101069055Help
Entry
101069055         CDS       T02386                                 

Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101069055
   00350 Tyrosine metabolism
    101069055
   00380 Tryptophan metabolism
    101069055
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101069055
   00760 Nicotinate and nicotinamide metabolism
    101069055
   00830 Retinol metabolism
    101069055
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101069055
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101069055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1329 aa AA seqDB search
MSTQKQGDTLCFFVNGKKVTENHADPETMLLSFLRQKLRLTGTKYGCGGGGCGACTVMLS
RYQPATKTITHLSANACLLPICQLHGAAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFC
TPGMVMSIYTLLRNKPKPSMEDITQALAGNLCRCTGYRPIIDGCRTFCQEAKCCGADGNG
NCCLNGEEKVLELEPPRLFDENDFLPLDPTQELIFPPELILMAETSNPKTLSFFGERVTW
VSTATLEDLVQLKSMNPKAPLIMGNTNIGPDMKFKGVFHPLIVSPTRVLELFEVNQTHDG
VWVGAGCSLSELQSLLASLVLKFPDEKTELFRALIQQLGNLGNQQIRNVASLGGNIVSAY
PNSDLNPLLAAGSSKVSVISKRGCRMVPLNQDFFVSFGKTVLKPEEVVVSVFIPFSKKGE
FVRAFRHAPRKEGSFATVTTGMRVLFAEGSNVVRDISIYYGGMGATIVSAAKTCSIITMR
PWNDETLNKAYNVLLEELDLPPSAPGGKVEFRRSLTLSFLFRFNLEVLQKFREMNITDKI
PEKIEPLPKEIDSGLQEFQPVSEDQNLQDPVGRPLMHRSAISQATGEAVYCDDLPMTDGE
LFMVLVTSSRAHAKITGMDVSEALRLPGVADVITAADIPGQKVRMLFGYEEELLADRQVS
CIGQMLCAVVADTREHAKRGAAAVKISYEDLPDPIFTIEEAVARSSFFEPQRRLERGNVD
EAFNAAEHLYEGGIQTGGQEHFYMETQSILVIPAGEEMEYKVYASSQWPALVQTAVAETL
NIPSNRVSCHVKRIGGAFGGKVTKTSILACITSVAACKTGRAVRCVLERGEDMLITGARH
PVQGKYKVGFMNDGTILGADFQFYANAGNTVDESLWVAEKMVLLLDNIYNIPNLRGRAAA
CRTNLPSNTAFRGFGVPQGLLVVENMLNDVAMVLGCPADKIREVNMYKGESVTLCKFKFN
AENVRRCWDDCKSKSDYDNRRSAVDQFNRQNRWKKRGMSIIPIKYGIGFSESSLNQAAAL
VHIYKDGSVLVTHGGAEMGQGLHTKVQQVASRELHIPLSKIYISETSTTTVPNTCSSAAS
FGTDANGMAVKDACQTLYQRLEPIRQKNPKGSWESWISEAYLEKVSLSATGFFRGQDLYI
DWEKMEGNPFAYFTYGVCCCEVELDCLSGDYRTLGADIVMDIGRSVNPSVDIGQIEGGFM
QGLGLYTLEELKFSPSGLLYTRGPSQYKIPAVCDVPLRFNVYLLPDSHNPHAIYSSKGIG
EPTVFLGSSVFFAIKDAVAAARSESGLVGPFSLDSPAIPERVCLACVSPFTQMIPINKPG
SFKPWAINI
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcagaagcaaggagatactttgtgcttttttgtcaacggaaaaaaggttaca
gagaaccatgctgaccctgaaaccatgctgctctccttcctcagacagaaactgaggcta
acggggaccaagtatggctgcggaggcggaggctgcggcgcgtgcacggtcatgctgtca
cgctatcaacctgcgaccaaaaccatcacacacctttccgccaacgcctgcctcctgcca
atctgccagcttcacggagccgctgtgaccacggtggagggcatcggcagcaccaagacc
aggctccacccagtgcaggagcgaatagccaagtctcacggctcccagtgtggcttctgc
acgcccgggatggtgatgtccatttacactctgctgaggaacaagcccaaacccagcatg
gaggacatcacgcaggcgttggctggtaatttgtgccgttgtactggatatcgacccatc
atcgatggctgcaggacgttctgtcaggaagctaagtgctgtggagccgacgggaatgga
aattgttgcctgaatggagaagagaaggttctagagctggaaccgccccgcttgtttgac
gagaatgactttttgcctttggacccgacgcaggagctcatcttcccaccagaactaatt
ttgatggcagaaacatcgaacccaaagactctgagcttctttggggagagggtgacctgg
gtgtctactgccaccctggaggatctggtccagcttaagtccatgaacccaaaagcccca
ctgatcatgggaaacaccaacataggtcccgatatgaagttcaaaggcgtttttcaccct
ctgattgtatctccaaccagagttctggaactgtttgaggtcaatcagacccatgacggt
gtttgggtcggagcaggatgtagtctgtctgagctgcagtctctcttggccagtctggtt
ctaaagtttccagatgagaagacggaactcttcagagctttgatccagcagttggggaac
ctgggaaaccagcagatccgaaacgttgcttctcttggaggaaacattgtgagtgcatat
ccaaactcagacctgaacccacttttggctgctggaagcagcaaagttagcgttatttca
aagagaggatgccgcatggttccgctgaaccaggatttctttgtgagttttgggaaaact
gtcctgaagcctgaggaggttgttgtctctgtctttattcccttctccaaaaagggggag
tttgttcgagctttccgacacgctccgaggaaggagggctcttttgccaccgtgaccact
gggatgagagtgcttttcgcagagggatcaaatgtggttcgtgacatcagtatctactac
ggaggaatgggagcgaccattgttagcgccgccaagacctgctctataattacgatgagg
ccttggaatgatgagaccctcaataaggcctacaacgtcctcctggaggagttggacctc
cctccgtcagcccctggaggaaaggttgagttccgtcgctccttgactctcagcttcctc
ttcagattcaacctggaggtcctgcagaagttcagagaaatgaacattacagacaaaatt
cctgagaagatcgagcctctgcccaaagagatcgactccggcctgcaggagttccagcct
gtgtcagaagaccagaacttgcaggacccggtgggacgtcccctcatgcatcgctctgcc
atcagccaggccacaggcgaggccgtgtactgcgacgacctccccatgacagacggggag
ctcttcatggttctggtcaccagctccagagcacatgctaaaatcacgggaatggacgtg
agcgaggccctgcggctcccaggggtggccgacgtcatcactgcagccgacatccccggg
cagaaggtccgcatgctgtttggatatgaggaagagctcctggccgatcgtcaggtgtct
tgcattggccaaatgttgtgcgctgtggtcgctgatacgagggagcacgccaaacgagga
gcggcggctgtgaagatcagctatgaagacctgccagatcccatttttacaatagaggaa
gctgtagccaggtcgtccttctttgagcctcagaggaggctcgagaggggtaacgtggat
gaagcttttaacgccgctgagcacctgtatgaaggaggaatccaaacaggaggccaggaa
catttctacatggagacccagagcatactagtcattcctgctggtgaggaaatggagtat
aaggtttacgcttcctctcagtggccagcgttagttcagactgcagtcgcggagacgctg
aacatcccgtccaacagagtctcctgtcacgtcaaaaggatcggaggcgcttttggtggg
aaggtcaccaaaacctcaatcctggcctgcatcacatccgtggcagcctgcaaaaccgga
cgcgcggtgcgctgtgtcctggagcgaggcgaggacatgctgatcacaggagctcgccat
cctgttcagggaaaatacaaggtgggtttcatgaatgacggaacgatcttgggcgcagat
ttccagttctacgccaacgctgggaacaccgtggatgaatccttatgggttgcagaaaag
atggtgcttcttctcgacaatatctacaacatccccaacctgcggggccgtgctgctgcc
tgcagaaccaacctgccctccaacaccgccttcaggggctttggtgtgccccaaggactt
ctggtggtggagaacatgttgaatgatgttgccatggttctgggatgtcctgcagacaag
attcgggaggtcaacatgtacaaaggtgagtccgtcacgctctgcaaattcaagttcaac
gcggagaacgtgcggcgctgctgggacgactgcaagagcaaatccgactacgacaaccgc
cgctcggccgtggaccagtttaacaggcagaaccggtggaagaagcggggcatgtccatc
atccccatcaaatacgggatcggtttcagcgagagcagcctgaaccaggcggcggcgctg
gtccatatttacaaagacggttctgttctggtcactcacggaggggcggagatgggtcag
ggacttcacaccaaagtgcaacaggtggcgagtcgggagcttcatatcccgctgtcaaag
atctacatcagcgaaacgagcaccaccactgttcccaacacctgctcttccgctgcgtcc
ttcgggaccgatgccaacggcatggcggtcaaggatgcctgccagactttgtaccaacga
ctggagccaatcaggcagaagaaccccaaaggatcatgggagagttggatcagtgaagcg
tacttggagaaagtcagtttatcagccacagggttcttcaggggtcaggatctttacatt
gactgggagaagatggagggcaatcctttcgcgtacttcacatacggagtctgctgctgt
gaggtggagctggactgcctctccggagactacaggacactgggggctgacatcgtgatg
gacatcgggagaagcgtgaatccgtctgtggacatcggccagatcgaaggagggttcatg
cagggtttgggtctctacactcttgaggagctcaagttttccccctctggtcttctctac
actcgggggccgtctcagtataagatccctgccgtctgcgacgtgccgcttcgcttcaat
gtctatctgctgcctgactcccacaaccctcacgccatctactcatccaagggcattgga
gaacccaccgtctttctgggcagctctgtgttcttcgccatcaaagacgccgtggcggct
gcccgctctgagtccgggttggtcggcccgttttccctggacagccctgcgattccagag
agggtctgcctggcctgcgtctcgccgttcactcagatgattcccattaacaaaccagga
tctttcaaaccgtgggctataaacatctaa

DBGET integrated database retrieval system