KEGG   Takifugu rubripes (torafugu): 101069055Help
Entry
101069055         CDS       T02386                                 

Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tru00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tru00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:tru00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tru00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tru00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:tru00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:tru00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1329 aa AA seqDB search
MSTQKQGDTLCFFVNGKKVTENHADPETMLLSFLRQKLRLTGTKYGCGGGGCGACTVMLS
RYQPATKTITHLSANACLLPICQLHGAAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFC
TPGMVMSIYTLLRNKPKPSMEDITQALAGNLCRCTGYRPIIDGCRTFCQEAKCCGADGNG
NCCLNGEEKVLELEPPRLFDENDFLPLDPTQELIFPPELILMAETSNPKTLSFFGERVTW
VSTATLEDLVQLKSMNPKAPLIMGNTNIGPDMKFKGVFHPLIVSPTRVLELFEVNQTHDG
VWVGAGCSLSELQSLLASLVLKFPDEKTELFRALIQQLGNLGNQQIRNVASLGGNIVSAY
PNSDLNPLLAAGSSKVSVISKRGCRMVPLNQDFFVSFGKTVLKPEEVVVSVFIPFSKKGE
FVRAFRHAPRKEGSFATVTTGMRVLFAEGSNVVRDISIYYGGMGATIVSAAKTCSIITMR
PWNDETLNKAYNVLLEELDLPPSAPGGKVEFRRSLTLSFLFRFNLEVLQKFREMNITDKI
PEKIEPLPKEIDSGLQEFQPVSEDQNLQDPVGRPLMHRSAISQATGEAVYCDDLPMTDGE
LFMVLVTSSRAHAKITGMDVSEALRLPGVADVITAADIPGQKVRMLFGYEEELLADRQVS
CIGQMLCAVVADTREHAKRGAAAVKISYEDLPDPIFTIEEAVARSSFFEPQRRLERGNVD
EAFNAAEHLYEGGIQTGGQEHFYMETQSILVIPAGEEMEYKVYASSQWPALVQTAVAETL
NIPSNRVSCHVKRIGGAFGGKVTKTSILACITSVAACKTGRAVRCVLERGEDMLITGARH
PVQGKYKVGFMNDGTILGADFQFYANAGNTVDESLWVAEKMVLLLDNIYNIPNLRGRAAA
CRTNLPSNTAFRGFGVPQGLLVVENMLNDVAMVLGCPADKIREVNMYKGESVTLCKFKFN
AENVRRCWDDCKSKSDYDNRRSAVDQFNRQNRWKKRGMSIIPIKYGIGFSESSLNQAAAL
VHIYKDGSVLVTHGGAEMGQGLHTKVQQVASRELHIPLSKIYISETSTTTVPNTCSSAAS
FGTDANGMAVKDACQTLYQRLEPIRQKNPKGSWESWISEAYLEKVSLSATGFFRGQDLYI
DWEKMEGNPFAYFTYGVCCCEVELDCLSGDYRTLGADIVMDIGRSVNPSVDIGQIEGGFM
QGLGLYTLEELKFSPSGLLYTRGPSQYKIPAVCDVPLRFNVYLLPDSHNPHAIYSSKGIG
EPTVFLGSSVFFAIKDAVAAARSESGLVGPFSLDSPAIPERVCLACVSPFTQMIPINKPG
SFKPWAINI
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcagaagcaaggagatactttgtgcttttttgtcaacggaaaaaaggttaca
gagaaccatgctgaccctgaaaccatgctgctctccttcctcagacagaaactgaggcta
acggggaccaagtatggctgcggaggcggaggctgcggcgcgtgcacggtcatgctgtca
cgctatcaacctgcgaccaaaaccatcacacacctttccgccaacgcctgcctcctgcca
atctgccagcttcacggagccgctgtgaccacggtggagggcatcggcagcaccaagacc
aggctccacccagtgcaggagcgaatagccaagtctcacggctcccagtgtggcttctgc
acgcccgggatggtgatgtccatttacactctgctgaggaacaagcccaaacccagcatg
gaggacatcacgcaggcgttggctggtaatttgtgccgttgtactggatatcgacccatc
atcgatggctgcaggacgttctgtcaggaagctaagtgctgtggagccgacgggaatgga
aattgttgcctgaatggagaagagaaggttctagagctggaaccgccccgcttgtttgac
gagaatgactttttgcctttggacccgacgcaggagctcatcttcccaccagaactaatt
ttgatggcagaaacatcgaacccaaagactctgagcttctttggggagagggtgacctgg
gtgtctactgccaccctggaggatctggtccagcttaagtccatgaacccaaaagcccca
ctgatcatgggaaacaccaacataggtcccgatatgaagttcaaaggcgtttttcaccct
ctgattgtatctccaaccagagttctggaactgtttgaggtcaatcagacccatgacggt
gtttgggtcggagcaggatgtagtctgtctgagctgcagtctctcttggccagtctggtt
ctaaagtttccagatgagaagacggaactcttcagagctttgatccagcagttggggaac
ctgggaaaccagcagatccgaaacgttgcttctcttggaggaaacattgtgagtgcatat
ccaaactcagacctgaacccacttttggctgctggaagcagcaaagttagcgttatttca
aagagaggatgccgcatggttccgctgaaccaggatttctttgtgagttttgggaaaact
gtcctgaagcctgaggaggttgttgtctctgtctttattcccttctccaaaaagggggag
tttgttcgagctttccgacacgctccgaggaaggagggctcttttgccaccgtgaccact
gggatgagagtgcttttcgcagagggatcaaatgtggttcgtgacatcagtatctactac
ggaggaatgggagcgaccattgttagcgccgccaagacctgctctataattacgatgagg
ccttggaatgatgagaccctcaataaggcctacaacgtcctcctggaggagttggacctc
cctccgtcagcccctggaggaaaggttgagttccgtcgctccttgactctcagcttcctc
ttcagattcaacctggaggtcctgcagaagttcagagaaatgaacattacagacaaaatt
cctgagaagatcgagcctctgcccaaagagatcgactccggcctgcaggagttccagcct
gtgtcagaagaccagaacttgcaggacccggtgggacgtcccctcatgcatcgctctgcc
atcagccaggccacaggcgaggccgtgtactgcgacgacctccccatgacagacggggag
ctcttcatggttctggtcaccagctccagagcacatgctaaaatcacgggaatggacgtg
agcgaggccctgcggctcccaggggtggccgacgtcatcactgcagccgacatccccggg
cagaaggtccgcatgctgtttggatatgaggaagagctcctggccgatcgtcaggtgtct
tgcattggccaaatgttgtgcgctgtggtcgctgatacgagggagcacgccaaacgagga
gcggcggctgtgaagatcagctatgaagacctgccagatcccatttttacaatagaggaa
gctgtagccaggtcgtccttctttgagcctcagaggaggctcgagaggggtaacgtggat
gaagcttttaacgccgctgagcacctgtatgaaggaggaatccaaacaggaggccaggaa
catttctacatggagacccagagcatactagtcattcctgctggtgaggaaatggagtat
aaggtttacgcttcctctcagtggccagcgttagttcagactgcagtcgcggagacgctg
aacatcccgtccaacagagtctcctgtcacgtcaaaaggatcggaggcgcttttggtggg
aaggtcaccaaaacctcaatcctggcctgcatcacatccgtggcagcctgcaaaaccgga
cgcgcggtgcgctgtgtcctggagcgaggcgaggacatgctgatcacaggagctcgccat
cctgttcagggaaaatacaaggtgggtttcatgaatgacggaacgatcttgggcgcagat
ttccagttctacgccaacgctgggaacaccgtggatgaatccttatgggttgcagaaaag
atggtgcttcttctcgacaatatctacaacatccccaacctgcggggccgtgctgctgcc
tgcagaaccaacctgccctccaacaccgccttcaggggctttggtgtgccccaaggactt
ctggtggtggagaacatgttgaatgatgttgccatggttctgggatgtcctgcagacaag
attcgggaggtcaacatgtacaaaggtgagtccgtcacgctctgcaaattcaagttcaac
gcggagaacgtgcggcgctgctgggacgactgcaagagcaaatccgactacgacaaccgc
cgctcggccgtggaccagtttaacaggcagaaccggtggaagaagcggggcatgtccatc
atccccatcaaatacgggatcggtttcagcgagagcagcctgaaccaggcggcggcgctg
gtccatatttacaaagacggttctgttctggtcactcacggaggggcggagatgggtcag
ggacttcacaccaaagtgcaacaggtggcgagtcgggagcttcatatcccgctgtcaaag
atctacatcagcgaaacgagcaccaccactgttcccaacacctgctcttccgctgcgtcc
ttcgggaccgatgccaacggcatggcggtcaaggatgcctgccagactttgtaccaacga
ctggagccaatcaggcagaagaaccccaaaggatcatgggagagttggatcagtgaagcg
tacttggagaaagtcagtttatcagccacagggttcttcaggggtcaggatctttacatt
gactgggagaagatggagggcaatcctttcgcgtacttcacatacggagtctgctgctgt
gaggtggagctggactgcctctccggagactacaggacactgggggctgacatcgtgatg
gacatcgggagaagcgtgaatccgtctgtggacatcggccagatcgaaggagggttcatg
cagggtttgggtctctacactcttgaggagctcaagttttccccctctggtcttctctac
actcgggggccgtctcagtataagatccctgccgtctgcgacgtgccgcttcgcttcaat
gtctatctgctgcctgactcccacaaccctcacgccatctactcatccaagggcattgga
gaacccaccgtctttctgggcagctctgtgttcttcgccatcaaagacgccgtggcggct
gcccgctctgagtccgggttggtcggcccgttttccctggacagccctgcgattccagag
agggtctgcctggcctgcgtctcgccgttcactcagatgattcccattaacaaaccagga
tctttcaaaccgtgggctataaacatctaa

DBGET integrated database retrieval system