KEGG   Takifugu rubripes (torafugu): 101069423Help
Entry
101069423         CDS       T02386                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 528 aa AA seqDB search
MASLNRCGSRAREAKMFLLTFLLWLLPALETVKVSPLIEKVGDHKDFKKLLRTRTNVLVL
YTKSDTSGDPHLKLLSDVAQTVKGQGTIAWVNCGDSEGRKLCKKVKVDPNSKRGGAELLH
YKDGTFHTEYNRARTFKSMVAFLKDPSGPPLWEENPEAKDVVHIETEKDFRKLLKREERP
ILVMFYAPWCGVCKRMQPVFQQAATETKGKYVLAGMNVHPAEFDGLKQEYNVKGYPTFCY
FEKGKFLHHYENYGATAKDIADWMKDPQAPQPKTPEVPWSESGSSVFHLTDDSFDGFLEE
HPAVLVMFYAPWCGHCKKMKPEYDEAAEILNKGVDSPGVLAAVDATVHKGVGDRFKISGF
PSLKYFVKGEEKYTLPQLRSKDKIIEFMHNPQAPPPPEQSWEERPSGVSHLGSEDFREAM
KKKKHALVMFYAPWCPHCKSSIPHFTTAAELFKEDRKIIYAAVDCTKGQNHELCKQEGVE
GYPTFNHYNYGKFVEKYNGERGEDGFTGFMRNLRGRDQEKVGKKKEEL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctgaaccgctgcgggagtcgggcgagagaggcgaaaatgttcctcttgacg
ttcctgctgtggctgctgccagcgttggagacggtgaaggtttcccctctcatcgagaag
gtcggcgaccacaaggatttcaagaagctgctccggaccagaaccaacgtcctggtgctc
tacaccaagtcagatacatccggggacccccacctgaaactgttgtcggacgtagcccag
acggtaaaaggccaagggacgatcgcctgggtgaactgtggggattcagagggccgcaag
ctgtgtaagaaggtcaaggtggacccaaactccaaacgtggaggagcagagctgttgcat
tacaaagatgggacattccacacagagtacaacagggccagaacctttaaatccatggta
gcctttttaaaagacccgtcaggaccaccgctgtgggaggaaaaccccgaggcaaaagat
gttgtccacatagaaacggagaaagacttcaggaagctactgaagagggaggaaaggcct
atcctcgtgatgttctacgccccatggtgtggcgtctgtaagaggatgcagccggtgttc
cagcaggccgccacagagaccaaagggaaatatgttctggcaggaatgaacgtgcatcca
gccgagtttgacggcctcaagcaggagtacaacgtcaaaggctacccgactttctgctac
tttgagaaaggaaagttcctccaccactatgaaaactatggagccacagccaaggatata
gcagactggatgaaagaccctcaggccccacagccaaagaccccagaggtgccttggtcc
gagtcgggctcctcggtcttccatctgactgacgattcctttgacggttttctggaggag
catccagctgtcctggtcatgttttatgccccctggtgtggacactgcaagaagatgaag
ccagagtatgatgaagctgctgaaatactcaacaagggcgtggatagtccgggcgtgctg
gcagcagtggacgccaccgtgcacaagggggtgggggatcgcttcaagatctccggcttc
ccgagtctgaaatactttgtgaagggcgaggagaagtacacgctgccgcagctccgcagt
aaagacaagatcatcgagttcatgcacaatccacaagccccccctccaccagagcagtcc
tgggaggagaggccctctggggtcagccatcttggctctgaggactttcgggaggctatg
aaaaagaaaaaacatgccctggtgatgttctacgccccctggtgtccccattgtaaaagc
tctattcctcacttcaccacagcagcagagctctttaaagaggaccggaagatcatttat
gctgcagtggactgtacaaaaggacagaaccacgagctgtgcaagcaggaaggcgtggaa
ggttatccaacctttaatcactacaactacggcaagtttgtggaaaaatacaacggcgag
cgcggggaggacggcttcacgggcttcatgcgcaacctcagaggacgagaccaggagaag
gtcggcaagaagaaggaagaactctga

DBGET integrated database retrieval system