KEGG   Takifugu rubripes (torafugu): 101069514Help
Entry
101069514         CDS       T02386                                 

Definition
DNA repair and recombination protein RAD54B-like
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tru03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1164 aa AA seqDB search
MRRSGAPSQLSGNAMKKPRFLPPASSSSYPSAEPKPLTPKPSLCNTLQKVKTCAKMASNS
TFLASMVGKARSSNFTLSEKLDLLKLVRPHIRILEEHTNKHAVIVDKNKCWDTVAEEYNA
LGGDRPLRTAQGLRTLYKRLKESAKQEVMQRRHAQPEYRSSISEPTRRIMEMIPHLFHNV
PIHEKDQALCRLIYNKHSSSIEHPGSSSSLGGLQDYSAAVPCIPHEVVQLDPEEDVKPPP
DLSILATHAGPELDKGHEQEVEQDLGSVHDYEASLSPTPSSVNVPFLTSPLPSRHSLYHD
DIYRHRDHDRLRPLHLAKEEHELVLANHRKVALYLEEKREGLKRKQELEEELLRAKIKPS
AGSTHVTAGTDPGCTQEVARYFSVMWCKASKKKHKRWEGDAVLITRGRAATLKDMEGKDI
GKGSGYKVSVLASLCDGDTLMIGGKEVEVMGVISQEDFARGRCFQDFQVEKSEPPPSSAG
RLLSKPFCPPTLLGGGHSGSRPEEEETCKSRHDPMAPGALVMPRPSSNHQWSHNKSGLPV
VDVVVDPHVNVHLRPHQREGLIFLYECVMGMRAAGGSGAILADEMGLGKTLQSVALSWTL
LKQGPYGGKPVVKRVLVVTPGSLVQNWGREFNKWLGRERIQVFTVDQDHRVEHFVLSPLH
SVLVISYEMLLRCLDQVQKVEFGLIICDEGHRLKNSSIKTSSALNSLSCSRRVILTGTPV
QNDLQEFYAIIEFVNPGILGSSTAYRKVYEEPILHSRQPSCTEEERVLGEERAAELSRLT
GMFILRRTQEIINRYLPPRLDWTLFCAPSPLQLELYKHLLCHRVFRSCLQAATQTHTHLA
CITALKKLCNHPVLLYSTVQERTDNGSEEGSFYEGLAELFPGSYSSGELTTADSGKLMVL
SDLLGAIRRLSPSDRVVVVSNYTKTLDLLEDLCVAMGYTFCRLDGHTPTGQRQRLVDSFN
SAYSQNFLFLLSSKAGGVGLNLVGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYR
LLTAGTIEERVFQRQVSKQGLSGTVVDLGKGAEHATFSTNELRDLFSLTDTPCLTHDLLG
CSCSVDGSAIVPAEEEQQVSDRPCQLGRPGDRGGMTQKHLSMSELMQWRHFSGDTHTFSD
PYLDHARHHITFAFQTTISNGAQD
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgttcaggagctcccagtcagctctcaggaaatgcaatgaaaaagccacggttt
ctgcccccagcatcatccagctcttatccctcggctgaacccaagccccttacccccaaa
ccaagtttatgcaacacattacagaaggtgaaaacatgcgctaagatggcgtccaactct
acatttctcgccagcatggtgggtaaagctcgctcttctaacttcaccctctccgagaag
ctggacctgttgaagctggtccgtcctcacatccgcatcctggaggagcacaccaataag
cacgcggtcatcgtggacaagaacaaatgttgggataccgtggccgaggagtacaacgcc
ttaggaggggacagaccccttcgtactgctcaaggcctcaggaccctctacaaaagacta
aaggagtcagccaagcaggaagtgatgcaacggagacacgcccagcccgagtacaggtcc
agcatctctgagccaaccaggagaattatggagatgatccctcacttgtttcacaatgtg
cccatccacgagaaagaccaggcactgtgcaggttaatatacaataaacacagctcttcc
atcgaacatcctggcagcagctcctctctgggtggactccaggattactcagcagctgtt
ccctgtatcccccacgaggtggtccagctggacccggaagaggacgttaaaccaccacca
gatctctccatccttgccacacatgcggggccggagctggacaaaggccacgagcaggaa
gtggagcaggacttgggcagcgtccacgattacgaggcgtcgctctctccgactccctcc
tccgtcaacgtccccttcttgacctcgccgctcccctcgcgccacagcctctaccacgac
gatatctaccgccaccgcgaccacgacaggctccggcctctgcacctggccaaagaggag
cacgagctggtgttggccaatcacaggaaggtggcgttgtatctggaggagaagcgagag
ggcctgaagagaaaacaagagctggaggaggaacttttacgagcgaagatcaaaccttca
gcggggtccacacatgtgactgctggcacagatcctggctgcactcaggaggtcgcacgt
tacttcagtgtgatgtggtgtaaggccagtaagaagaaacataagcgctgggaaggtgac
gcggtgctgatcacgagaggacgcgcggccacgctgaaggatatggagggcaaagacatc
ggaaaagggagcggatataaagtgtccgttctggcgtcgctgtgtgacggggacacactt
atgatcggagggaaggaggtggaggtgatgggagtcatttctcaagaggactttgccagg
ggacgatgtttccaggatttccaggtggagaaatcggagccaccgccctccagtgctggt
cgcttgctgtccaaacctttctgccctccaacattactgggggggggtcattcaggatcc
agacccgaggaggaggagacctgcaaatctcgccacgacccaatggctccaggtgcactt
gtgatgcctcgcccctcttctaaccaccagtggagtcacaataagtcggggcttcctgtg
gttgatgtggtggtcgaccctcacgtgaatgttcacctgcgtccacaccagagagaaggc
ctgatctttctctatgagtgtgtcatggggatgagggctgctggcggttctggagccatt
ctggccgacgagatgggtctgggaaagactctccagagtgttgcactgtcctggactttg
cttaaacaaggaccatacggggggaaaccagtggtgaagcgtgtcctcgtggtcacccct
ggcagcctcgtgcagaactgggggagagagtttaataagtggctgggccgcgagcggatc
caggttttcactgtggatcaggaccacagggtagaacactttgtattgtcgcctctccac
agcgttctggtcatcagctacgaaatgctcctgcgctgcctggatcaggtgcagaaagtg
gagttcggcctcatcatctgcgacgagggccacagattgaagaacagcagcatcaagacg
tcttcagctctcaacagcctgagctgcagccgcagagtaattctgacaggcaccccggta
caaaatgacctgcaggagttctacgccatcattgagtttgttaacccggggattctcggg
tcatccactgcgtataggaaggtgtacgaagagcctattctacactccaggcagccctct
tgtacagaggaggagcgagttttaggagaggagcgagcggcagagctctctcgtctgact
ggcatgtttatcctgaggcgcacgcaggagataatcaaccgctacctgcctccccggctc
gactggacgctgttctgcgcgccctcccctctgcagctggagctgtacaagcatctcctc
tgccacagagtcttcagatcttgccttcaggccgccacacaaactcacacccacttggcc
tgcatcactgccctgaaaaagctgtgtaaccaccccgtcctgctgtattccaccgtccag
gaaagaacagataatggatcggaagaaggatcattctatgaagggctggcagagctcttc
ccaggatcctactcttcaggtgaactcactactgcggactctggaaaactcatggttctc
tcagacctgctgggcgccatcagacgactcagcccatcagacagggtggtcgtggtgtcc
aactacactaagaccctcgatttgctcgaagacttgtgcgtcgctatgggttacaccttc
tgccgtcttgacggacacacgcccactggccagaggcagcggctggtcgacagttttaac
agcgcctattctcagaacttcttgttcttgctcagctcaaaagcaggcggagtgggcctg
aatctggtgggggcttcccacctggtgctgtatgatattgactggaatccagcaaatgac
atacaggccatggctcgagtatggagagatggacagaaaaagacggtgcacatctatcgt
ctcctcacggcagggactattgaggagcgcgtgttccaaagacaggtgtccaaacaaggg
ctctccgggaccgtggttgacctgggcaagggggcagagcacgccaccttctccaccaat
gagctgcgagatctttttagcctaacagacacaccatgtttaacgcacgacctgctcggc
tgcagctgcagcgtggatggttcagccatagttccagcagaagaagagcagcaggtctct
gacaggccctgccagctcggtcgccctggcgaccgcggagggatgactcagaaacatctc
agcatgtcagagctgatgcagtggagacatttttctggtgacacacacaccttctcagat
ccatacctggaccacgcacgacaccacatcaccttcgctttccagaccaccatctccaac
ggggcgcaggactaa

DBGET integrated database retrieval system