KEGG   Takifugu rubripes (torafugu): 101069514Help
Entry
101069514         CDS       T02386                                 

Gene name
rad54b
Definition
(RefSeq) RAD54 homolog B (S. cerevisiae)
  KO
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    101069514 (rad54b)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     101069514 (rad54b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 938 aa AA seqDB search
MRRSGAPSQLSGNAMKKPRFLPPASSSSYPSAEPKPLTPKPSLCNTLQKVQRNLTAAAVV
CNVEREVRPKAVRAAPVLSRALARVLNATESKENEAEEEHSDHDMGESPKDTKPSGLKSD
PELTCESPGVSQPSAGSTHVTAGTDPGCTQEVARYFSVMWCKASKKKHKRWEGDAVLITR
GRAATLKDMEGKDIGKGSGYKVSVLASLCDGDTLMIGGKEVEVMGVISQEDFARGRCFQD
FQVEKSEPPPSSAGRLLSKPFCPPTLLGGGHSGSRPEEEETCKSRHDPMAPGALVMPRPS
SNHQWSHNKSGLPVVDVVVDPHVNVHLRPHQREGLIFLYECVMGMRAAGGSGAILADEMG
LGKTLQSVALSWTLLKQGPYGGKPVVKRVLVVTPGSLVQNWGREFNKWLGRERIQVFTVD
QDHRVEHFVLSPLHSVLVISYEMLLRCLDQVQKVEFGLIICDEGHRLKNSSIKTSSALNS
LSCSRRVILTGTPVQNDLQEFYAIIEFVNPGILGSSTAYRKVYEEPILHSRQPSCTEEER
VLGEERAAELSRLTGMFILRRTQEIINRYLPPRLDWTLFCAPSPLQLELYKHLLCHRVFR
SCLQAATQTHTHLACITALKKLCNHPVLLYSTVQERTDNGSEEGSFYEGLAELFPGSYSS
GELTTADSGKLMVLSDLLGAIRRLSPSDRVVVVSNYTKTLDLLEDLCVAMGYTFCRLDGH
TPTGQRQRLVDSFNSAYSQNFLFLLSSKAGGVGLNLVGASHLVLYDIDWNPANDIQAMAR
VWRDGQKKTVHIYRLLTAGTIEERVFQRQVSKQGLSGTVVDLGKGAEHATFSTNELRDLF
SLTDTPCLTHDLLGCSCSVDGSAIVPAEEEQQVSDRPCQLGRPGDRGGMTQKHLSMSELM
QWRHFSGDTHTFSDPYLDHARHHITFAFQTTISNGAQD
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgttcaggagctcccagtcagctctcaggaaatgcaatgaaaaagccacggttt
ctgcccccagcatcatccagctcttatccctcggctgaacccaagccccttacccccaaa
ccaagtttatgcaacacattacagaaggttcagaggaatctcacagcagcagcagttgtg
tgtaacgtggagcgtgaagtgcggcccaaagccgtccgagctgctccagttctgtcgagg
gctctggctcgggtcctcaatgcaacagaaagtaaagaaaatgaggcagaagaagaacat
tctgaccacgacatgggagagagcccaaaagacaccaaaccatcaggattgaagtctgac
cctgagttgacctgtgagtctcctggtgtctcacagccttcagcggggtccacacatgtg
actgctggcacagatcctggctgcactcaggaggtcgcacgttacttcagtgtgatgtgg
tgtaaggccagtaagaagaaacataagcgctgggaaggtgacgcggtgctgatcacgaga
ggacgcgcggccacgctgaaggatatggagggcaaagacatcggaaaagggagcggatat
aaagtgtccgttctggcgtcgctgtgtgacggggacacacttatgatcggagggaaggag
gtggaggtgatgggagtcatttctcaagaggactttgccaggggacgatgtttccaggat
ttccaggtggagaaatcggagccaccgccctccagtgctggtcgcttgctgtccaaacct
ttctgccctccaacattactgggggggggtcattcaggatccagacccgaggaggaggag
acctgcaaatctcgccacgacccaatggctccaggtgcacttgtgatgcctcgcccctct
tctaaccaccagtggagtcacaataagtcggggcttcctgtggttgatgtggtggtcgac
cctcacgtgaatgttcacctgcgtccacaccagagagaaggcctgatctttctctatgag
tgtgtcatggggatgagggctgctggcggttctggagccattctggccgacgagatgggt
ctgggaaagactctccagagtgttgcactgtcctggactttgcttaaacaaggaccatac
ggggggaaaccagtggtgaagcgtgtcctcgtggtcacccctggcagcctcgtgcagaac
tgggggagagagtttaataagtggctgggccgcgagcggatccaggttttcactgtggat
caggaccacagggtagaacactttgtattgtcgcctctccacagcgttctggtcatcagc
tacgaaatgctcctgcgctgcctggatcaggtgcagaaagtggagttcggcctcatcatc
tgcgacgagggccacagattgaagaacagcagcatcaagacgtcttcagctctcaacagc
ctgagctgcagccgcagagtaattctgacaggcaccccggtacaaaatgacctgcaggag
ttctacgccatcattgagtttgttaacccggggattctcgggtcatccactgcgtatagg
aaggtgtacgaagagcctattctacactccaggcagccctcttgtacagaggaggagcga
gttttaggagaggagcgagcggcagagctctctcgtctgactggcatgtttatcctgagg
cgcacgcaggagataatcaaccgctacctgcctccccggctcgactggacgctgttctgc
gcgccctcccctctgcagctggagctgtacaagcatctcctctgccacagagtcttcaga
tcttgccttcaggccgccacacaaactcacacccacttggcctgcatcactgccctgaaa
aagctgtgtaaccaccccgtcctgctgtattccaccgtccaggaaagaacagataatgga
tcggaagaaggatcattctatgaagggctggcagagctcttcccaggatcctactcttca
ggtgaactcactactgcggactctggaaaactcatggttctctcagacctgctgggcgcc
atcagacgactcagcccatcagacagggtggtcgtggtgtccaactacactaagaccctc
gatttgctcgaagacttgtgcgtcgctatgggttacaccttctgccgtcttgacggacac
acgcccactggccagaggcagcggctggtcgacagttttaacagcgcctattctcagaac
ttcttgttcttgctcagctcaaaagcaggcggagtgggcctgaatctggtgggggcttcc
cacctggtgctgtatgatattgactggaatccagcaaatgacatacaggccatggctcga
gtatggagagatggacagaaaaagacggtgcacatctatcgtctcctcacggcagggact
attgaggagcgcgtgttccaaagacaggtgtccaaacaagggctctccgggaccgtggtt
gacctgggcaagggggcagagcacgccaccttctccaccaatgagctgcgagatcttttt
agcctaacagacacaccatgtttaacgcacgacctgctcggctgcagctgcagcgtggat
ggttcagccatagttccagcagaagaagagcagcaggtctctgacaggccctgccagctc
ggtcgccctggcgaccgcggagggatgactcagaaacatctcagcatgtcagagctgatg
cagtggagacatttttctggtgacacacacaccttctcagatccatacctggaccacgca
cgacaccacatcaccttcgctttccagaccaccatctccaacggggcgcaggactaa

DBGET integrated database retrieval system