KEGG   Takifugu rubripes (torafugu): 101069572Help
Entry
101069572         CDS       T02386                                 

Definition
eukaryotic translation initiation factor 4E type 2-like
Orthology
K03259  
translation initiation factor 4E
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101069572
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    101069572
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101069572
Translation factors [BR:tru03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    101069572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 222 aa AA seqDB search
MNQLERPKDERIQEESECHHDNSDGTNNNNRRKTVCPAVGEHPLQYNYTFWYSRRTPSRP
ASSQSYEQNIRQIGTVASVEQFWRFYSHLIRPGDLSGHSDFHLFKEGIKPMWEDESNRSG
GKWIIRLRKGLASRFWENIILAMLGEQFMVGEEICGAVVSIRFQEDILSIWNRTSNDQMT
TSRIRDTLRRVLNLPTNTIMEYKTHNDSLRDNSSFRNTKISL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagctggagcgtccaaaagacgagagaatccaagaagagtctgagtgtcaccat
gacaacagtgatggaacaaacaacaacaatcgacgcaagacagtgtgtccagcggtagga
gaacaccccctccagtacaactacaccttctggtacagcagaagaacgccgagtcgtcct
gcaagttctcagagttatgagcaaaacattcggcagattggcaccgtagcatcggtggag
cagttctggaggttttacagtcacctgattcgaccaggtgatctgagtggacacagtgac
tttcacctgttcaaggaggggatcaaaccgatgtgggaggacgagtcgaaccgcagtggg
gggaagtggatcatccgtctgcggaaaggtctggccagtcggttctgggagaacatcata
ctggccatgctgggagaacagttcatggtgggggaggagatctgtggcgctgttgtctcc
atacgcttccaggaggatatcctgtcgatctggaacagaacctctaatgaccaaatgacg
acgtcaagaattcgagacactttgagacgagttctgaaccttcccaccaacaccatcatg
gagtacaagacccacaatgacagcctcagggacaactccagcttcagaaataccaagatc
tccctctga

DBGET integrated database retrieval system