KEGG   Takifugu rubripes (torafugu): 101069652Help
Entry
101069652         CDS       T02386                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 260 aa AA seqDB search
MGSAPYPAGEWKGKGRGGLQELGCMRWKVSKQKAAGGVEVMVGTEERRSRDLTDAQQQQQ
DLSSSSSSLTPPLPPQAALTTPAIYHEKQRRELCALHALNNVFQDGTAFSRDTLQEICQR
LSPSTLVTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGSIELSNVTGFILNV
PSNMRWGPFRLPLKRQHWIGVREVGGIYYNLDSKLRGPQPIGNSDELRKFLRQQLRGKNC
ELLLVVSEEVEAQQSWRTDG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgcaccatatccagctggtgagtggaagggcaaaggtcgaggtggattacag
gaactgggctgcatgcgatggaaggttagcaagcagaaagcagcaggaggagtggaggtg
atggtgggaacagaggaaagaaggtccagggatctcacggacgctcagcagcagcagcag
gatctttcctcctcctcctcctctctcactcctcccctgcctcctcaagctgctctgaca
actccagccatttaccacgagaagcagcggagggagctgtgcgcactccatgctctcaac
aacgttttccaggacgggacggccttcagcagggacacactgcaggaaatatgccagaga
ctttctccaagcactctggtgacacctcacaagaagagcatgctgggaaatgggaactat
gacgtaaacgtcatcatggcagccctgcagactcggggatttgaggctgtttggtgggat
aaaagaagggatgttggcagcatcgagctttccaacgttacaggcttcattctgaacgtg
ccatccaacatgcgctgggggcctttccgtttgcctctcaaacgtcaacactggatagga
gtcagagaggtgggggggatctactacaacctggactcaaagctgcgcggcccgcaaccc
atcggcaactcggatgagctcaggaagttcctccgccagcagctgcgagggaagaactgt
gaactcttactggtggtgtcagaggaagtggaggcgcaacaatcatggcggactgatggc
taa

DBGET integrated database retrieval system