KEGG   Takifugu rubripes (torafugu): 101069652Help
Entry
101069652         CDS       T02386                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101069652
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C86
   101069652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 260 aa AA seqDB search
MGSAPYPAGEWKGKGRGGLQELGCMRWKVSKQKAAGGVEVMVGTEERRSRDLTDAQQQQQ
DLSSSSSSLTPPLPPQAALTTPAIYHEKQRRELCALHALNNVFQDGTAFSRDTLQEICQR
LSPSTLVTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGSIELSNVTGFILNV
PSNMRWGPFRLPLKRQHWIGVREVGGIYYNLDSKLRGPQPIGNSDELRKFLRQQLRGKNC
ELLLVVSEEVEAQQSWRTDG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgcaccatatccagctggtgagtggaagggcaaaggtcgaggtggattacag
gaactgggctgcatgcgatggaaggttagcaagcagaaagcagcaggaggagtggaggtg
atggtgggaacagaggaaagaaggtccagggatctcacggacgctcagcagcagcagcag
gatctttcctcctcctcctcctctctcactcctcccctgcctcctcaagctgctctgaca
actccagccatttaccacgagaagcagcggagggagctgtgcgcactccatgctctcaac
aacgttttccaggacgggacggccttcagcagggacacactgcaggaaatatgccagaga
ctttctccaagcactctggtgacacctcacaagaagagcatgctgggaaatgggaactat
gacgtaaacgtcatcatggcagccctgcagactcggggatttgaggctgtttggtgggat
aaaagaagggatgttggcagcatcgagctttccaacgttacaggcttcattctgaacgtg
ccatccaacatgcgctgggggcctttccgtttgcctctcaaacgtcaacactggatagga
gtcagagaggtgggggggatctactacaacctggactcaaagctgcgcggcccgcaaccc
atcggcaactcggatgagctcaggaagttcctccgccagcagctgcgagggaagaactgt
gaactcttactggtggtgtcagaggaagtggaggcgcaacaatcatggcggactgatggc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system