KEGG   Takifugu rubripes (torafugu): 101069670Help
Entry
101069670         CDS       T02386                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101069670
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101069670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 304 aa AA seqDB search
MISALQTVPVLVALSVLVLTVLWFLMRGSAAGRRPPVTLQDPTVKYPLCLIDKQEISHDT
KKFRFALPSENHILGLPVGQHVYLSAKVNGSLVVRAYTPVSSDENRGFVDLVVKVYYKDS
HPTYPEGGKMSQYLDSMAIGDTIDFRGPSGLLVYKENGRFSIRPDKKSEPVVRKFKHVGM
IAGGTGITPMLQLIRRITADADDGTKCSLIFANQTEKDILLREELEEVKRKHPDKVHLWF
TLDRAPQEWSYSSGFVTQDMIKDHLPAPAADVLIVLCGPPPMIQYACLPHLDKLGHPTEN
IFTY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgccctgcagaccgtcccggtgctggtggcactttctgtgcttgtgctcacc
gtgctgtggttcctcatgcgaggctctgcagcaggacgcaggccgccggtcactctgcag
gatcccacggtcaaatatccgctgtgtctcatcgacaagcaggaaatcagccacgacaca
aagaaattccgctttgctcttccatctgaaaaccatatcctgggcctgccagtaggccaa
cacgtgtacctctcagccaaggtgaacggcagcctggtggtcagagcgtacacgccggtg
tccagcgatgagaaccggggatttgtcgacctcgtcgtcaaggtgtactacaaggactcc
caccccacctaccctgaaggggggaagatgtctcagtatctggacagcatggctatcggg
gacacgattgacttcaggggacccagtgggctgctggtgtacaaggaaaatggtcggttc
tccatccgaccagacaagaagtccgagccagtagtgcggaagttcaagcatgttgggatg
atcgctggtggaacaggcatcactccgatgctgcagctaatacgcaggatcacggcggat
gcagacgacggcaccaagtgctccctcatatttgccaaccagacggaaaaagacatcctt
ctgagggaggagctggaggaggtgaagaggaaacaccctgacaaagttcatctctggttc
acacttgacagagctccacaagaatggagctacagttcaggttttgtgacccaggacatg
atcaaggaccacctccctgctccggccgctgatgtcctcattgtcctttgcggcccacct
ccaatgatccagtacgcctgcctgccgcacctggacaagctgggccacccaacggaaaac
atctttacatactaa

DBGET integrated database retrieval system