KEGG   Takifugu rubripes (torafugu): 101069779Help
Entry
101069779         CDS       T02386                                 

Definition
voltage-dependent calcium channel subunit alpha-2/delta-3-like
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:tru04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:tru04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 1045 aa AA seqDB search
MLGVWRLLLAHACSTSLPLWIILGLNAVETAGSQQGIPLSVVKLWASAFGGEIKSISAKY
SGSQLLQKKHKEFVKTVKVEEIDGMKLVKNLAVKMEEVFQKKAEATRRLVEAAEEAHRQH
EENPELQYEYFNAVLINEVDEMGNNVELGGEFLLEPNDHFNNLSVNVSLSVVQVPTNMYN
KDPDIVNGVYWSEALNKVFVDNFERDPTLTWQYFGSAKGFFRQYPGVKWHPDEHGVIGFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNQE
IHYVEPCLNGTLVRADRTNKDHFREHLDKLFAKGIGLLGEALAEAFTILSDFNRTGRGSV
CSQAIMLVTDGATEMYDDVFEKYNWPERKVRIFPYLIGRESAFADNLKWMACANKGYFSQ
ISTLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAYVDSALSQAHKLNEKVGPSLMTTVA
MPVFSTKNETKNQGILLGVVGTDIPLPELMKLIPKHMLGIHGYAFAITNNGYILTHPDLR
PLYQDGQKRRKPNYSSVDLSEVEWEDKDDFLRNSMVNRRTGTFSMEVKKTVDRGRRVLKM
HNDYYFTDIKGTPFSVGVALSRGHGKYFFRGNVSVEAGLRDLEQPDVALADEWTYCNTEE
KHEHRHLTQIQAIKLFMTSRRPNLKCDRELIQEVLFDAVVTAPLEAYWTGLALNKSENSD
KGVEITFLGTRTGLSRTNLFIPADQLSNQDFLTAEDKEGVFNADHFPLWYKRAAEQVPGT
FVYSIPFSTGKKNKSVVLASTAIQLLDDRKSPIVAAVGIQMKLEFFQRKFWTACRQCTAL
DGKCSISCDSEDINCYLIDNNGFILVTEEQSQTGLFFGEVEGAVMNKLLQMGSFKRITLY
DYQALCKEYTGSSDSARTLSDXXXXXXXXXISERTIKETTGNIDCEGCVRSFVIQQIPSS
NLFMVVVDNKCDCSSVPPVTMDPIEIMYNESLKCDRLKFQKDRKKPESCHPFHPEENAME
CGSATRLSTALTTALLPLIAAGISR
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggtctggaggctcctgttggcgcacgcgtgcagcaccagcctcccgctctgg
atcatcctgggcttgaacgcggtggagacggcagggtcccagcaggggatcccactgtca
gtcgtgaagctctgggcttcagcatttggtggggaaatcaagtccatctcagctaaatac
tctggatcacagctgctgcagaagaaacataaagagtttgtaaagacagtcaaagtggaa
gaaatagatggaatgaagctggtcaaaaatctggctgtgaagatggaggaagtcttccag
aaaaaggcagaagccaccagacggctggtggaggcagcagaagaagcgcaccgtcagcat
gaggagaaccccgagctgcagtatgaatacttcaacgctgtgctgatcaatgaagtggat
gagatgggaaacaacgtggagctggggggagagttcctcctggagcccaacgaccacttc
aacaacctgtcagtcaacgtgagcctcagtgtggtgcaggtgcccaccaacatgtacaac
aaagatcctgacatcgtgaacggagtctactggtccgaggcgctgaacaaagtgttcgta
gataattttgaaagggacccgacgctgacctggcagtattttgggagcgccaaaggcttt
ttcaggcagtatcccggggtaaagtggcatccagatgaacatggcgtgattgggttcgac
tgcaggaacagaaagtggtacatccaggccgccacctctccgaaggacgtcgtgatctta
gtggatgtcagcggcagcatgaaaggtctcaggctgaccatcgcccgacagaccgtctcc
tccatattggacacactgggagacgacgacttcttcaacatcattgcctataatcaggag
atccactacgtggagccgtgtttgaatgggacgctggtgcgggccgacagaaccaacaaa
gatcacttccgggaacatctggacaagctgtttgcaaaagggatcggcctgctgggcgaa
gctctggccgaggccttcaccatcctcagcgactttaatcgcaccggacggggcagcgtg
tgcagccaggctataatgctcgtgactgacggtgccacagaaatgtatgatgatgttttt
gagaagtataactggccagaacgaaaggtgcgaatattcccttacctgattggacgggag
tcggcgtttgctgacaacctgaaatggatggcctgtgccaacaaagggtacttcagccag
atctccactttagcggacgttcaggagaacgtgatgaggtaccttcatgtcatgagccgc
ccaaaggtcatcgaccacgagcatgacaccgtgtggactgaagcttatgtggacagtgct
ctttcccaggctcataagttgaatgaaaaagttgggccaagtctgatgaccacagtcgcc
atgcccgtcttcagcaccaagaatgagacaaagaaccagggtattctgttgggggtcgtc
ggaacagacattcctctgccggagttgatgaagctcatcccaaaacatatgctcgggatc
cacggctatgcatttgctatcaccaacaatggctacatcctgacacaccccgacctccga
cctttgtaccaggatggtcagaagaggaggaagccaaactacagcagcgtggatctctca
gaggtggagtgggaggacaaagatgactttctacgcaactctatggtgaaccggcgaacc
gggactttctctatggaggtgaagaagacagtggacagagggagacgagttctgaagatg
cacaatgattactacttcaccgacattaaagggacgccgttcagtgttggggtagctctc
tccagaggacacgggaagtactttttccgaggaaacgtctccgtcgaagccgggctccgt
gatctggaacagccagatgtcgccctggcagatgaatggacctactgcaacacagaggag
aagcatgaacaccgtcacctgacccaaattcaggccatcaagcttttcatgacgagccgc
agaccaaacctcaaatgtgacagagagctgatccaggaggtgttatttgatgcagtggtc
actgctccactggaggcctactggaccgggctggccctcaacaagtcagagaactcagac
aaaggggtggagatcaccttcctgggtacccgcactggtctgtcaaggaccaatctgttc
attcccgctgatcagctctctaatcaagatttcctgacagcggaggacaaagagggtgtc
tttaatgccgatcacttccctctgtggtacaagagagcggcagagcaggtcccaggcaca
tttgtgtactccattcccttcagcacaggtaagaaaaataagagcgtggtcttggccagt
acagccattcagctcctggatgacagaaagtctccaattgttgcagctgtggggatccaa
atgaaactggagttctttcagaggaagttctggactgcatgcagacagtgcacggccctg
gatggaaaatgtagcatcagctgtgacagcgaggacattaactgctatctcatcgataac
aacggtttcattctggtcacagaggagcaatctcagacagggctcttctttggagaggtg
gagggcgctgttatgaacaaactcctccagatgggctcttttaaaaggatcaccctgtac
gactaccaggccctgtgcaaggagtacactggaagcagcgacagtgctcgcacactatca
gacnnnnnnnnnnnnnnnnnnnnnnnnntcatctctgaacgcaccatcaaagaaacaaca
ggcaacatcgactgtgagggctgcgtcagatcttttgtcatacagcagattcccagcagc
aacctgttcatggttgttgtggacaataagtgcgactgcagcagcgttcctccagtaaca
atggatcccattgagatcatgtacaacgagtcacttaaatgtgacaggctgaagtttcag
aaggacaggaagaagcctgagtcatgccatccattccacccagaggaaaatgcgatggag
tgtggctcagcgacgcgcctctccactgctttaacaacagctctgcttcctctgatcgct
gccggcatcagcaggtga

DBGET integrated database retrieval system