KEGG   Takifugu rubripes (torafugu): 101069895Help
Entry
101069895         CDS       T02386                                 

Definition
(RefSeq) DNA repair protein XRCC4-like
  KO
K10886  
DNA-repair protein XRCC4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    101069895
DNA repair and recombination proteins [BR:tru03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     101069895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 336 aa AA seqDB search
MHQTSVRPVHVPSEPDSSYFLRVDWSGRGLGSGFELLLTDGQNAWRGDVSEAAVCREAEE
LEMQPERYIQDLQQALTGTEKSTNYSFVLTPSPPNSSSAVTLAYEKVQRDISFRMGSVLL
KAVPEPTEAVRELLVHSLQRGNALERHNGKLEEENQRLIEEHQRITAELKHYAGDKEALE
AELYSRFVLVLNEKKAKIRSLQQNITRLQEASADKQQKKDSVKCDQSAGQEQDEYGGSTD
EEPGDARETAASASLPPEASAEGPLDDSLKDITDVAPCRKRRFRHVPAPQPEVKRPQRSQ
KRRPDPPGGSSKHQTPQRSTDAAAASPDTEDLFGDF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagacatcagtacggccagtccacgtcccatctgaacctgactcctcctacttc
ctgcgggttgactggagtgggcgtggcttaggctcgggctttgagttgctgctgactgat
ggacagaatgcttggagaggagatgtcagtgaagcagcagtgtgtcgggaggctgaggaa
ctggagatgcagcctgagcgttacatccaggacctccagcaggcgctgacaggaacggaa
aaatccaccaactacagcttcgtcctgacgccatctcctcccaacagcagctccgccgtc
acgctggcctacgagaaggttcagagggacatttctttcaggatgggctctgtgctgctg
aaagccgtcccagagccaacggaggcagtgagggagttactggtccacagtctccagagg
ggaaacgctttggaacgccacaacggcaaacttgaagaggagaaccaaagattgattgaa
gaacatcaacgcatcactgctgaactgaaacattatgcaggcgataaagaagccctggag
gccgagctgtactctcgattcgtcctggttctgaatgaaaagaaagcaaaaatccgttct
ctacagcaaaacatcacacgactacaggaggcaagcgccgataaacaacaaaagaaggat
tcggtaaaatgcgaccaatcagcaggccaggagcaggacgaatatggcgggagcactgac
gaggagccaggggacgcccgggagacggcagcctctgcttctcttcccccagaggcctct
gctgagggcccgctggacgacagcttgaaggacatcaccgacgtggccccttgtcgcaaa
cgtcgctttcgccacgtcccggccccccagcctgaagtcaaacgaccccaacgctcccag
aaaaggagacccgacccccctggaggatccagtaagcaccagactccccagcgctctaca
gatgctgcagcagcaagtcctgacactgaagacctatttggagatttttga

DBGET integrated database retrieval system