KEGG   Takifugu rubripes (torafugu): 101069895Help
Entry
101069895         CDS       T02386                                 

Definition
DNA repair protein XRCC4-like
Orthology
K10886  
DNA-repair protein XRCC4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    101069895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 375 aa AA seqDB search
MTVMPIIVKHMMSVLASVFTVVSSSRRFTGRMHQTSVRPVHVPSEPDSSYFLRVDWSGRG
LGSGFELLLTDGQNAWRGDVSEAAVCREAEELEMQPERYIQDLQQALTGTEKSTNYSFVL
TPSPPNSSSAVTLAYEKVQRDISFRMGSVLLKAVPEPTEAVRELLVHSLQRGNALERHNG
KLEEENQRLIEEHQRITAELKHYAGDKEALEAELYSRFVLVLNEKKAKIRSLQQNITRLQ
EASADKQQKKDSVKCDQSAGQEQDEYGGSTDEEPGDARETAASASLPPEASAEGPLDDSL
KDITDVAPCRKRRFRHVPAPQPEVKRPQRSQKRSRCEPCHMQMVVSDASYPQLLSPFGSG
ARYQSCCGKTQLLAS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgatgccgatcatagtgaaacacatgatgtcggtcctggcgtctgtctttact
gtggtctccagcagtcgcaggttcacaggcagaatgcaccagacatcagtacggccagtc
cacgtcccatctgaacctgactcctcctacttcctgcgggttgactggagtgggcgtggc
ttaggctcgggctttgagttgctgctgactgatggacagaatgcttggagaggagatgtc
agtgaagcagcagtgtgtcgggaggctgaggaactggagatgcagcctgagcgttacatc
caggacctccagcaggcgctgacaggaacggaaaaatccaccaactacagcttcgtcctg
acgccatctcctcccaacagcagctccgccgtcacgctggcctacgagaaggttcagagg
gacatttctttcaggatgggctctgtgctgctgaaagccgtcccagagccaacggaggca
gtgagggagttactggtccacagtctccagaggggaaacgctttggaacgccacaacggc
aaacttgaagaggagaaccaaagattgattgaagaacatcaacgcatcactgctgaactg
aaacattatgcaggcgataaagaagccctggaggccgagctgtactctcgattcgtcctg
gttctgaatgaaaagaaagcaaaaatccgttctctacagcaaaacatcacacgactacag
gaggcaagcgccgataaacaacaaaagaaggattcggtaaaatgcgaccaatcagcaggc
caggagcaggacgaatatggcgggagcactgacgaggagccaggggacgcccgggagacg
gcagcctctgcttctcttcccccagaggcctctgctgagggcccgctggacgacagcttg
aaggacatcaccgacgtggccccttgtcgcaaacgtcgctttcgccacgtcccggccccc
cagcctgaagtcaaacgaccccaacgctcccagaaaaggagccgctgtgagccatgccac
atgcagatggtcgtgagcgatgccagttatccccagctgctgtcgccgttcggtagcggc
gcccgttaccaatcctgctgcggcaagacgcagcttttagccagttag

DBGET integrated database retrieval system