KEGG   Takifugu rubripes (torafugu): 101070046Help
Entry
101070046         CDS       T02386                                 

Definition
angiopoietin-2-like
Orthology
K05466  
angiopoietin 2
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 473 aa AA seqDB search
MGTRCSAAVKREYNIQHGQCSYTFLLPEPENCQTQSSNYPVQKDGPMDQDESAQRLEQLE
MTMENNTQWLLKLENYIQDSMKQDIVQLQQTAVHNHTATMIEIGTNLLSQTAEQTRKLTN
VEAQVIHHTARLERRLLENSLSTNKLEKQLIVQTNEINKLKDKTSILEKKLMDMEEQKQV
DLKTLQDEKEQLETLILRQTALIGEMEEQLLRVSSNNTFLQQQQQELLDTVNGLIQTISA
GSVPESKSVMMRDTPSTFLDCAAVFKSGNTQSGVYTLTLPNTTTEVKAFCDMETDGGGWT
VLQKRFDGTVDFNRTWQEYKKGFGEPSKEFWLGNEFISRLTNQHSYKLRIELSDWEGNSG
FSQYDEFSLESEAQNYRIHFKGYSGTAGKISSIGQSGSDFSTKDADNDKCVCKCSQLITG
GWWFDACGPSNLNGIYYQQRQNSNRFNGIKWYYWKGSRYSLKSTAMMVRPADF
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggggacaaggtgcagtgcggctgtcaagagagagtacaacatccaacatgggcagtgt
agctacaccttcctgctgcccgagccggaaaactgccagacccagagcagcaactaccca
gttcaaaaggacggacccatggaccaggacgagtccgctcagaggctggagcagctggag
atgaccatggagaacaacacacagtggctgctgaagctggagaactacatacaggacagc
atgaagcaggacatcgtccaactacaacagactgcagtccacaaccatacggcaacaatg
attgaaattggaacaaacctgctcagccaaaccgcagagcaaacaaggaaactgaccaat
gtggaggctcaggtgattcatcacacagctcgtctcgaacggagacttcttgaaaactct
ctgtcaaccaacaaactggagaaacagctcattgtccaaacaaatgaaattaacaagctg
aaagacaaaaccagcattctggagaaaaaactgatggacatggaggagcagaagcaggtg
gatctgaagacgctccaagatgaaaaagagcaactggagactctcatcctgaggcagacg
gccctcattggggagatggaggagcagctcctcagagtctcctccaacaacaccttcctg
cagcagcagcagcaggagctactggacactgtcaacggtctcattcaaacaatctctgca
ggttccgtcccagagagcaaaagtgtcatgatgagggacaccccaagcacgttcctggac
tgtgctgccgtcttcaagtcaggaaacacccagagcggcgtctacaccctcacgttaccc
aacactactactgaggttaaggctttctgcgacatggagacagatggaggtgggtggaca
gtgctacaaaaacgctttgacggcaccgttgactttaaccgtacgtggcaggaatataaa
aaggggtttggagaaccttccaaggaattctggctaggaaatgagtttatttccagactt
acaaatcagcattcttacaaactcaggattgagctgagtgactgggaaggaaactcagga
ttctctcagtacgacgagttctccctggagagcgaagcacaaaactacaggatacacttt
aaaggctacagtggaacagcaggcaaaataagcagcatcgggcagtcaggaagtgatttc
agtacaaaggatgcagacaatgacaaatgtgtttgcaaatgttcacaactcataacaggc
ggttggtggtttgatgcctgcggtccatccaatttaaacgggatctactaccaacaacgt
caaaactcaaatcgattcaacggcattaagtggtactactggaaaggctccagatattca
ctgaagtccacagcaatgatggtcagaccagcggatttctga

DBGET integrated database retrieval system