KEGG   Takifugu rubripes (torafugu): 101070046Help
Entry
101070046         CDS       T02386                                 

Gene name
angpt2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101070046 (angpt2)
Cytokines and growth factors [BR:tru04052]
 Growth factors
  Growth factors (RTK binding)
   101070046 (angpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 101070046
NCBI-ProteinID: XP_003964212
UniProt: H2ULU9
Position
4
AA seq 489 aa AA seqDB search
MKTSNANLLVLSLCLVMGTRCSAAVKREYNIQHGQCSYTFLLPEPENCQTQSSNYPVQKD
GPMDQDESAQRLEQLEMTMENNTQWLLKLENYIQDSMKQDIVQLQQTAVHNHTATMIEIG
TNLLSQTAEQTRKLTNVEAQVIHHTARLERRLLENSLSTNKLEKQLIVQTNEINKLKDKT
SILEKKLMDMEEQKQVDLKTLQDEKEQLETLILRQTALIGEMEEQLLRVSSNNTFLQQQQ
QELLDTVNGLIQTISAGSVPESKSVMMRDTPSTFLDCAAVFKSGNTQSGVYTLTLPNTTT
EVKAFCDMETDGGGWTVLQKRFDGTVDFNRTWQEYKKGFGEPSKEFWLGNEFISRLTNQH
SYKLRIELSDWEGNSGFSQYDEFSLESEAQNYRIHFKGYSGTAGKISSIGQSGSDFSTKD
ADNDKCVCKCSQLITGGWWFDACGPSNLNGIYYQQRQNSNRFNGIKWYYWKGSRYSLKST
AMMVRPADF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctcgaatgccaatttactagtcttgagtttgtgccttgttatggggacaagg
tgcagtgcggctgtcaagagagagtacaacatccaacatgggcagtgtagctacaccttc
ctgctgcccgagccggaaaactgccagacccagagcagcaactacccagttcaaaaggac
ggacccatggaccaggacgagtccgctcagaggctggagcagctggagatgaccatggag
aacaacacacagtggctgctgaagctggagaactacatacaggacagcatgaagcaggac
atcgtccaactacaacagactgcagtccacaaccatacggcaacaatgattgaaattgga
acaaacctgctcagccaaaccgcagagcaaacaaggaaactgaccaatgtggaggctcag
gtgattcatcacacagctcgtctcgaacggagacttcttgaaaactctctgtcaaccaac
aaactggagaaacagctcattgtccaaacaaatgaaattaacaagctgaaagacaaaacc
agcattctggagaaaaaactgatggacatggaggagcagaagcaggtggatctgaagacg
ctccaagatgaaaaagagcaactggagactctcatcctgaggcagacggccctcattggg
gagatggaggagcagctcctcagagtctcctccaacaacaccttcctgcagcagcagcag
caggagctactggacactgtcaacggtctcattcaaacaatctctgcaggttccgtccca
gagagcaaaagtgtcatgatgagggacaccccaagcacgttcctggactgtgctgccgtc
ttcaagtcaggaaacacccagagcggcgtctacaccctcacgttacccaacactactact
gaggttaaggctttctgcgacatggagacagatggaggtgggtggacagtgctacaaaaa
cgctttgacggcaccgttgactttaaccgtacgtggcaggaatataaaaaggggtttgga
gaaccttccaaggaattctggctaggaaatgagtttatttccagacttacaaatcagcat
tcttacaaactcaggattgagctgagtgactgggaaggaaactcaggattctctcagtac
gacgagttctccctggagagcgaagcacaaaactacaggatacactttaaaggctacagt
ggaacagcaggcaaaataagcagcatcgggcagtcaggaagtgatttcagtacaaaggat
gcagacaatgacaaatgtgtttgcaaatgttcacaactcataacaggcggttggtggttt
gatgcctgcggtccatccaatttaaacgggatctactaccaacaacgtcaaaactcaaat
cgattcaacggcattaagtggtactactggaaaggctccagatattcactgaagtccaca
gcaatgatggtcagaccagcggatttctga

DBGET integrated database retrieval system