KEGG   Takifugu rubripes (torafugu): 101070052Help
Entry
101070052         CDS       T02386                                 

Definition
thrombospondin-4-B-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:tru04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:tru04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:tru04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 938 aa AA seqDB search
MGVWTALVVALQLLLCLDVEAQVLVYDLITSPDCLPDLLQGGLVEQGVNEAFILTSFKLQ
PKTGTSVFGLYNPRDNSKYFEFTVMGKLNRAVLRYLRSDKRMSSVTFNNLVLADGQQHRL
LFHLKGMQQQGPGGVELHLDCRLVETVRDLPAAFQGLPAGYGLVELKTMQTRDQDSLDEL
KLVVGDSFENVASLQGCHFQQRDSVQTLGVNTKQLSNQMLELTKVVNELKDVLIQQVKET
SFLRNTISECQACGLGGTEVVKPRCVPGICFREDMCIETAEGVECGPCPDGYTGDGFNCD
DVDECQFNPCFPGVKCVNTAPGYRCEACPLGYTGLPVEGVGVVFAQTNKQICDDVDECNR
PDNGGCASNSMCHNSVGSYHCGSCKTGFTGDQVKGCKPEISCGNSLTNPCSANAQCITER
DGSITCQCGIGWAGNGYLCGKDTDIDGYPDEKLKCKDPSCKKDNCVYVPNSGQEDADRDG
QGDTCDEDADGDSIPNERDNCWLKPNLDQKNSDKDTHGDACDNCRLVENPDQRDTDGDGK
GDSCDDDMDGDGRKNILDNCQRVQNRDQLDRDGDGVGDACDSCPDIPNPNQSDIDNDLVG
DSCDTNQDSDGDGHQDTKDNCPLVINSSQQDTDKDGLGDECDDDDDDDGIPDILPPGPDN
CRLVPNPDQTDDNNDGVGDICESDFDQDKVIDRIDSCPENAEVTLTDFRAYQTVVLDPEG
DAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFIFGY
QDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSTTGPGEHLRNSLWHTGDTNDQ
VRLLWKDPRNVGWKDKVSYRWYLQHRPQVGYIRARFYEGTELVADSGVIIDTTMRGGRLG
VFCFSQENIIWSNLKYRCNDTIPEDFQEFSAQHSGDAL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgtggacagccctggttgtggccctgcagctgcttttatgcttggacgtggaa
gcccaggtgttagtgtatgatctgattacctcgcctgactgcctgccagacctcctgcag
ggcggcctggtggagcagggagtgaacgaggccttcatcctgacctccttcaagttgcag
cccaagaccgggacctctgtgtttggcctgtacaaccccagggacaacagcaagtacttc
gagttcaccgtgatggggaagctcaatcgagctgttttacgctacctgcgaagcgacaag
aggatgagctccgtaaccttcaacaacctggtgctggcagacggccagcagcaccgactg
ttgttccacctgaaggggatgcagcagcagggcccgggtggggtggagctgcatctggac
tgcaggctggtggagacggtcagggaccttcctgctgccttccagggtttgcctgccggc
tacggtttggtggagctcaagaccatgcaaaccagagaccaggacagtttggacgagctg
aagctggtggtcggggactccttcgagaatgtggcttcattacaaggctgtcacttccaa
caaagagactctgtccaaaccctgggggtcaacacgaagcagctgtccaaccaaatgctg
gagctaaccaaagtggtaaatgagctaaaagacgtcctcatccagcaggtcaaagagacg
tcatttctcagaaacaccatctcagagtgccaggcctgcggtctgggaggcaccgaggtg
gtgaagccaaggtgcgtgcctggcatctgcttccgtgaggacatgtgcatagagacggcc
gagggcgtcgagtgtggaccgtgtcctgacggctacactggggacggattcaactgcgac
gatgtggacgagtgccagtttaacccctgcttccctggagtgaagtgcgtcaacacggcg
ccggggtaccgctgcgaggcctgtccgctgggctacaccggcctgccggtggaaggggtg
ggggtcgtgttcgcccagaccaacaaacagatctgcgacgacgtcgacgagtgcaaccgg
cccgacaacggcggctgcgccagtaattcgatgtgtcacaactcggtgggctcgtaccac
tgtggcagttgcaagacgggcttcactggagatcaggtgaagggatgcaagccggagatc
agctgcgggaacagtctgaccaacccctgcagcgccaacgcccagtgcatcacagagagg
gacggctctatcacttgccagtgtggaattggctgggccggtaatggatacctgtgtggg
aaggacacggacatcgacggctaccctgacgagaagctgaagtgcaaagatcccagctgt
aaaaaggataactgcgtctacgtgccgaactctggtcaagaggacgccgacagggacggg
cagggggacacctgtgacgaggatgcagatggagacagtataccaaacgagcgggacaac
tgctggttgaagcctaacttggaccagaagaacagcgacaaggacacccacggcgacgcc
tgcgacaactgtcgcctggtagagaaccccgaccagagggacaccgacggcgacggcaaa
ggggactcctgcgacgacgacatggacggagacggccggaagaacatcctggacaattgt
cagcgcgtccagaaccgagaccaactggaccgggacggagacggagtaggagacgcctgc
gacagctgccctgatatccccaacccaaaccagtcggatattgacaatgacctggtggga
gactcctgcgacacaaaccaggacagcgatggcgacggtcaccaggataccaaggacaac
tgcccactggtgatcaacagctcgcagcaggacaccgacaaagacggcctgggtgacgag
tgcgatgacgacgatgacgacgacggcatccctgacattctgccgccaggaccagacaac
tgccggctggttccgaaccctgaccagactgacgacaacaatgacggcgtcggggacatc
tgtgagtcggacttcgaccaggacaaggtgatcgaccggatcgacagctgccccgagaac
gccgaggtcaccctgactgacttcagagcctatcaaacggtggttctggaccctgaaggc
gacgctcagattgaccccaactgggtggttttgaaccaggggatggagatcgttcagacg
atgaacagtgacccggggctggctgtcggttacacggctttcagcggcgtggactttgag
ggcacgtttcacgtcaatacggtgaccgatgacgactacgccggcttcatcttcggctac
caggactcgtcctcgttctacgtggtgatgtggaagcagaccgagcagacctactggcag
gccacgcccttcagagccgtggccgagcccggcatccagctgaaggctgtgaagtctaca
accggccctggggagcacctgaggaactcgctgtggcacacgggggacaccaacgaccag
gtccgcctgctgtggaaggaccccaggaacgtgggctggaaggacaaggtgtcctaccgc
tggtacctgcagcaccgcccgcaggtcgggtacatcagggcccggttttatgaaggaaca
gagctggtggcagactctggagtcatcatcgacacgaccatgagaggaggacgactcggc
gttttctgcttctcccaggagaacatcatctggtccaacttgaagtaccgctgcaatgac
accatccccgaggacttccaggagttcagcgctcaacacagcggagacgcgctgtaa

DBGET integrated database retrieval system