KEGG   Takifugu rubripes (torafugu): 101070052Help
Entry
101070052         CDS       T02386                                 

Definition
(RefSeq) thrombospondin-4-B-like
  KO
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101070052
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101070052
  Cellular community - eukaryotes
   04510 Focal adhesion
    101070052
Membrane trafficking [BR:tru04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101070052
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101070052
  Exosomal proteins of colorectal cancer cells
   101070052
  Exosomal proteins of bladder cancer cells
   101070052
Cell adhesion molecules and their ligands [BR:tru04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     101070052
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     101070052
   VNR
     101070052
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   101070052
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101070052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 938 aa AA seqDB search
MGVWTALVVALQLLLCLDVEAQVLVYDLITSPDCLPDLLQGGLVEQGVNEAFILTSFKLQ
PKTGTSVFGLYNPRDNSKYFEFTVMGKLNRAVLRYLRSDKRMSSVTFNNLVLADGQQHRL
LFHLKGMQQQGPGGVELHLDCRLVETVRDLPAAFQGLPAGYGLVELKTMQTRDQDSLDEL
KLVVGDSFENVASLQGCHFQQRDSVQTLGVNTKQLSNQMLELTKVVNELKDVLIQQVKET
SFLRNTISECQACGLGGTEVVKPRCVPGICFREDMCIETAEGVECGPCPDGYTGDGFNCD
DVDECQFNPCFPGVKCVNTAPGYRCEACPLGYTGLPVEGVGVVFAQTNKQICDDVDECNR
PDNGGCASNSMCHNSVGSYHCGSCKTGFTGDQVKGCKPEISCGNSLTNPCSANAQCITER
DGSITCQCGIGWAGNGYLCGKDTDIDGYPDEKLKCKDPSCKKDNCVYVPNSGQEDADRDG
QGDTCDEDADGDSIPNERDNCWLKPNLDQKNSDKDTHGDACDNCRLVENPDQRDTDGDGK
GDSCDDDMDGDGRKNILDNCQRVQNRDQLDRDGDGVGDACDSCPDIPNPNQSDIDNDLVG
DSCDTNQDSDGDGHQDTKDNCPLVINSSQQDTDKDGLGDECDDDDDDDGIPDILPPGPDN
CRLVPNPDQTDDNNDGVGDICESDFDQDKVIDRIDSCPENAEVTLTDFRAYQTVVLDPEG
DAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFIFGY
QDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSTTGPGEHLRNSLWHTGDTNDQ
VRLLWKDPRNVGWKDKVSYRWYLQHRPQVGYIRARFYEGTELVADSGVIIDTTMRGGRLG
VFCFSQENIIWSNLKYRCNDTIPEDFQEFSAQHSGDAL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgtggacagccctggttgtggccctgcagctgcttttatgcttggacgtggaa
gcccaggtgttagtgtatgatctgattacctcgcctgactgcctgccagacctcctgcag
ggcggcctggtggagcagggagtgaacgaggccttcatcctgacctccttcaagttgcag
cccaagaccgggacctctgtgtttggcctgtacaaccccagggacaacagcaagtacttc
gagttcaccgtgatggggaagctcaatcgagctgttttacgctacctgcgaagcgacaag
aggatgagctccgtaaccttcaacaacctggtgctggcagacggccagcagcaccgactg
ttgttccacctgaaggggatgcagcagcagggcccgggtggggtggagctgcatctggac
tgcaggctggtggagacggtcagggaccttcctgctgccttccagggtttgcctgccggc
tacggtttggtggagctcaagaccatgcaaaccagagaccaggacagtttggacgagctg
aagctggtggtcggggactccttcgagaatgtggcttcattacaaggctgtcacttccaa
caaagagactctgtccaaaccctgggggtcaacacgaagcagctgtccaaccaaatgctg
gagctaaccaaagtggtaaatgagctaaaagacgtcctcatccagcaggtcaaagagacg
tcatttctcagaaacaccatctcagagtgccaggcctgcggtctgggaggcaccgaggtg
gtgaagccaaggtgcgtgcctggcatctgcttccgtgaggacatgtgcatagagacggcc
gagggcgtcgagtgtggaccgtgtcctgacggctacactggggacggattcaactgcgac
gatgtggacgagtgccagtttaacccctgcttccctggagtgaagtgcgtcaacacggcg
ccggggtaccgctgcgaggcctgtccgctgggctacaccggcctgccggtggaaggggtg
ggggtcgtgttcgcccagaccaacaaacagatctgcgacgacgtcgacgagtgcaaccgg
cccgacaacggcggctgcgccagtaattcgatgtgtcacaactcggtgggctcgtaccac
tgtggcagttgcaagacgggcttcactggagatcaggtgaagggatgcaagccggagatc
agctgcgggaacagtctgaccaacccctgcagcgccaacgcccagtgcatcacagagagg
gacggctctatcacttgccagtgtggaattggctgggccggtaatggatacctgtgtggg
aaggacacggacatcgacggctaccctgacgagaagctgaagtgcaaagatcccagctgt
aaaaaggataactgcgtctacgtgccgaactctggtcaagaggacgccgacagggacggg
cagggggacacctgtgacgaggatgcagatggagacagtataccaaacgagcgggacaac
tgctggttgaagcctaacttggaccagaagaacagcgacaaggacacccacggcgacgcc
tgcgacaactgtcgcctggtagagaaccccgaccagagggacaccgacggcgacggcaaa
ggggactcctgcgacgacgacatggacggagacggccggaagaacatcctggacaattgt
cagcgcgtccagaaccgagaccaactggaccgggacggagacggagtaggagacgcctgc
gacagctgccctgatatccccaacccaaaccagtcggatattgacaatgacctggtggga
gactcctgcgacacaaaccaggacagcgatggcgacggtcaccaggataccaaggacaac
tgcccactggtgatcaacagctcgcagcaggacaccgacaaagacggcctgggtgacgag
tgcgatgacgacgatgacgacgacggcatccctgacattctgccgccaggaccagacaac
tgccggctggttccgaaccctgaccagactgacgacaacaatgacggcgtcggggacatc
tgtgagtcggacttcgaccaggacaaggtgatcgaccggatcgacagctgccccgagaac
gccgaggtcaccctgactgacttcagagcctatcaaacggtggttctggaccctgaaggc
gacgctcagattgaccccaactgggtggttttgaaccaggggatggagatcgttcagacg
atgaacagtgacccggggctggctgtcggttacacggctttcagcggcgtggactttgag
ggcacgtttcacgtcaatacggtgaccgatgacgactacgccggcttcatcttcggctac
caggactcgtcctcgttctacgtggtgatgtggaagcagaccgagcagacctactggcag
gccacgcccttcagagccgtggccgagcccggcatccagctgaaggctgtgaagtctaca
accggccctggggagcacctgaggaactcgctgtggcacacgggggacaccaacgaccag
gtccgcctgctgtggaaggaccccaggaacgtgggctggaaggacaaggtgtcctaccgc
tggtacctgcagcaccgcccgcaggtcgggtacatcagggcccggttttatgaaggaaca
gagctggtggcagactctggagtcatcatcgacacgaccatgagaggaggacgactcggc
gttttctgcttctcccaggagaacatcatctggtccaacttgaagtaccgctgcaatgac
accatccccgaggacttccaggagttcagcgctcaacacagcggagacgcgctgtaa

DBGET integrated database retrieval system