KEGG   Takifugu rubripes (torafugu): 101070139Help
Entry
101070139         CDS       T02386                                 

Definition
nuclear envelope pore membrane protein POM 121-like
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:tru03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1036 aa AA seqDB search
MGSYIGKPESPPAASGRPRVMRNPREQLREKLSRPNHAVYTPNRRLSFAGEPPGVPARFT
ITPQRHYPLQQPGISSVGVLPPVKWDGFRKKSILSPRNSMGILSPVTVKIARPDHHSSPS
VDHLSCAGLPKSPVDPCSRESVLKVLKESRKRNVEDEDRSFTTEQRNKRRRNDSGGSAHS
AFEPLLPNGTPSQLVPKPGSLKRGMTSLMEESIMKRSRTSSISSGTGFHAPRGTPGTTRN
PIHSSYSSTLGLSQRKKRSAPSPTMSSPGSSRSQTPEGASKRSREEEGQSPSSASSMKSD
QAASEKAAVTSDLTPVPKVPVTTSINSTGSGGKRKRRIQLISSHRDDNISLPPPPELGYT
ITVKDLDDEKKAAINKIQKILETPEPEKSVSPSDTALSQWPSTNSTTTTILSSLLAAPLP
TTSAAAIPVINLNPSPVTSVATSPAASSPLLEALKMKSSTPISSLSTVNSTTVVTPPSLA
KPIGLKLNVSSVTPQLTPVSQPQSSSVGVSIPSAFTQLPSQVSVAPSTAPNAGKPGLFGL
LGQSSTHTSASSPTSTVASTNSNSASVTSNPLLASGFKPIFAVTPTATSSTMSTPEIKPV
QTFKPIFGATTAGPGFQSSPITATNPASTLSSNITSSLFGSISSTTVAPSMFSSMSSTVT
GTTSANSVAATQNANQPALKSLFGNWTAPTAASTSSVPALVPNAGSTFQFGATTTTANPA
AAAAATAPAPAPAPSAATTSSSNGSFTFGATQPDPQAAKQKVFAFGQVAPSQNTTGASFG
GFGTVSTAVTTAPTTAQPAFSFGKSSFQAPTTQSVFGSSLTQATFGSSPSQPPKPFPFGG
GGTSSTTASNPAPSPFTFGAAAVTTTTSFVTPTKPAFGANSTGFAFGTSAAAAAPAAPSF
GASSQTQSATSGTFSFGGAPPQQTPSAPAPATPSGFNFGAAVTQFGTPVSNNAAPQMGSF
NFGAAAATDKPAFGTPTPTFGQSAAQGPIPFGTPAQGFNSVPFGASPTPSFSIGAGSKPS
GARQRLQARRQHNRKK
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggggagttacatcggtaaacccgaaagtcctcccgctgcctccgggaggccgagagtg
atgagaaatccccgagaacagctccgggaaaagctgtccagaccgaaccatgcagtttat
actccaaaccggagactgtcatttgctggggagcctcctggagtgccagctaggttcacc
atcaccccacagcgtcactaccccttgcagcagccgggtatctcatcagtgggtgtacta
ccgcctgtaaaatgggatggcttcaggaagaagagcatcctcagtcctcgcaactctatg
ggtatcctcagccctgtcacagtgaagattgcaaggcctgaccaccacagtagccccagt
gtagaccatttgagttgtgccggactcccgaagagccccgtggacccttgctcaagagaa
agcgtccttaaggtgttaaaggaaagtcgtaagagaaacgtagaggatgaagacagaagc
tttacaactgagcagaggaacaaaagaaggcgtaatgacagtggtgggagtgcacactct
gcttttgaacctctcttacccaatggaacaccatcacagctggttcccaaaccaggaagc
ctaaaaagaggaatgacctccctgatggaggagtccattatgaagaggtctcgcacatcc
tctattagttctggcactggattccatgcaccaagaggaaccccaggcaccacacgaaac
cccatccacagctcttacagctctacattggggctcagccagaggaagaaaaggtcagca
cccagtcccacgatgtccagccctggatcatctcgctcacagactccagagggagcctca
aaaagatccagagaggaagaaggacagtctcccagttcagcatcttctatgaagtcagac
caggcagcctctgagaaagcagctgtaacttctgacctgaccccggtccccaaggtccca
gtcactacctcaatcaactcaacgggtagtggcgggaaaaggaaacggaggatccagttg
atatccagccacagagatgataacatatctttgcccccacctccggaactgggctatacc
atcactgtgaaggaccttgatgatgagaagaaggctgccatcaacaagatccagaagatc
ctggagacacctgagccagagaagtctgtctctccttccgataccgccctttcccagtgg
ccttctactaactcgaccactacaaccattctgagcagtctgctagcagctccattgccc
acaacctctgctgctgccatcccagtcatcaatctaaacccaagccccgtgacgagcgtg
gctacatccccagcagcctctagcccactgcttgaggctctgaaaatgaagagcagcact
cctattagttctctatctactgtcaactcaactacagttgtgacaccaccctcactggct
aaacccattggcttaaagctgaatgtttcttcagtgactccacagttgacacctgtgtcc
cagcctcagtcctcctctgttggtgtctcgattccctctgcctttactcagctgccaagc
caggtgtctgtggcgcccagcactgctccgaatgctggaaaacctggactttttgggttg
ttgggccagagtagcacccacacctctgcttccagtcccacctctactgttgcctctacc
aacagcaactctgcttcagtcactagcaaccctctgttggcttcagggttcaagcccatc
ttcgccgtcacgccaacagcgacctcatcaactatgtcgaccccggagatcaaacctgtc
caaacattcaaacccatctttggcgccaccactgcaggacctgggtttcagtcttctccc
attacagctacaaacccagcttctacactttcttccaacattacatcgtctttgtttggc
tccataagcagcaccacagttgctccatccatgttctcgagcatgagcagcaccgtcact
ggcacaacctccgctaactctgtcgccgccacccaaaacgcaaaccagccagctttgaag
tcactctttggaaactggaccgcaccaactgcagcaagcaccagttcagttccagcgctg
gtccctaatgctggaagcacctttcagtttggggccactaccaccaccgccaacccggct
gcagcggcagcagcaacagcgcccgcccccgcccccgcccccagtgctgctaccacaagc
tctagcaatggctcctttacatttggagctacacaaccagaccctcaagctgcaaaacaa
aaggtatttgcatttggccaggtggcgccaagccagaatacaactggtgcatcttttggg
gggtttggcacagtgagcacagctgtcaccacagctcccaccactgctcagcctgctttc
agcttcggaaagtcgtcatttcaagcaccaaccacacagtctgtgtttggctcgtcattg
acacaggcaacatttggctcttcaccgtcacaacctcccaaaccgttcccgtttggaggc
ggcggcacgtcatccacgactgcctcaaatcctgctccatccccattcacctttggagca
gctgctgtcaccacgacaaccagctttgtgaccccgactaaaccagcgtttggggccaac
tctactggttttgcatttggcaccagtgcagcagcagcggctcctgctgcaccgagcttt
ggtgcgtcatctcagactcagagtgccacctctggcacattctcatttggtggagccccc
cctcagcagacgccctctgcccctgctccggcaacacccagtggatttaactttggcgct
gcagtaactcagtttgggaccccagtttctaataatgctgcaccgcagatgggaagcttc
aactttggggcggctgctgctactgataagccagcatttggcacacctacaccaaccttc
ggccaaagtgctgcccaaggtccaataccctttggaactccagctcaaggtttcaattct
gtaccttttggagcttcaccaactccctctttctccattggagctggatcaaaaccctct
ggggcaagacagaggctgcaggcacggcgacagcacaacaggaagaagtga

DBGET integrated database retrieval system