KEGG   Takifugu rubripes (torafugu): 101070139Help
Entry
101070139         CDS       T02386                                 

Gene name
pom121
Definition
(RefSeq) POM121 transmembrane nucleoporin
  KO
K14316  
nuclear pore complex protein Nup121
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101070139 (pom121)
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     101070139 (pom121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1162 aa AA seqDB search
MSPREKHLAILSALGLVTLAFYYIPVFLYLILFLIVCCILWYYHNGELLPARLGLYPRVK
LNVPFGIRRWLGGWGATGVSVAQRKRSKSSKNKTAVREPESNFGVTGVYRRESETESFIF
SPRDFLMGSYIGKPESPPAASGRPRVMRNPREQLREKLSRPNHAVYTPNRRLSFAGEPPG
VPARFTITPQRHYPLQQPGISSVGVLPPVKWDGFRKKSILSPRNSMGILSPVTVKIARPD
HHSSPSVDHLSCAGLPKSPVDPCSRESVLKVLKESRKRNVEDEDRSFTTEQRNKRRRNDS
GGSAHSAFEPLLPNGTPSQLVPKPGSLKRGMTSLMEESIMKRSRTSSISSGTGFHAPRGT
PGTTRNPIHSSYSSTLGLSQRKKRSAPSPTMSSPGSSRSQTPEGASKRSREEEGQSPSSA
SSMKSDQAASEKAAVTSDLTPVPKVPVTTSINSTGSGGKRKRRIQLISSHRDDNISLPPP
PELGYTITVKDLDDEKKAAINKIQKILETPEPEKSVSPSDTALSQWPSTNSTTTTILSSL
LAAPLPTTSAAAIPVINLNPSPVTSVATSPAASSPLLEALKMKSSTPISSLSTVNSTTVV
TPPSLAKPIGLKLNVSSVTPQLTPVSQPQSSSVGVSIPSAFTQLPSQVSVAPSTAPNAGK
PGLFGLLGQSSTHTSASSPTSTVASTNSNSASVTSNPLLASGFKPIFAVTPTATSSTMST
PEIKPVQTFKPIFGATTAGPGFQSSPITATNPASTLSSNITSSLFGSISSTTVAPSMFSS
MSSTVTGTTSANSVAATQNANQPALKSLFGNWTAPTAASTSSVPALVPNAGSTFQFGATT
TTANPAAAAAATAPAPAPAPSAATTSSSNGSFTFGATQPDPQAAKQKVFAFGQVAPSQNT
TGASFGGFGTVSTAVTTAPTTAQPAFSFGKSSFQAPTTQSVFGSSLTQATFGSSPSQPPK
PFPFGGGGTSSTTASNPAPSPFTFGAAAVTTTTSFVTPTKPAFGANSTGFAFGTSAAAAA
PAAPSFGASSQTQSATSGTFSFGGAPPQQTPSAPAPATPSGFNFGAAVTQFGTPVSNNAA
PQMGSFNFGAAAATDKPAFGTPTPTFGQSAAQGPIPFGTPAQGFNSVPFGASPTPSFSIG
AGSKPSGARQRLQARRQHNRKK
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctagagaaaagcatttagccatcctctctgctttaggcctcgttactttagcg
ttttattatattccagtgtttctctatcttattttatttctcatagtttgttgcattttg
tggtattatcacaacggtgaactacttccagccaggttgggcctttatccgcgggtgaaa
ttaaacgtcccatttgggatccggcgctggctggggggttggggggcaaccggcgtgtcg
gttgcacagcggaaaagaagtaagagtagcaaaaacaagaccgcggtccgggagccagag
agtaactttggagtaactggggtctaccggagagaatcggagactgaatcatttattttc
agccctcgggattttctcatggggagttacatcggtaaacccgaaagtcctcccgctgcc
tccgggaggccgagagtgatgagaaatccccgagaacagctccgggaaaagctgtccaga
ccgaaccatgcagtttatactccaaaccggagactgtcatttgctggggagcctcctgga
gtgccagctaggttcaccatcaccccacagcgtcactaccccttgcagcagccgggtatc
tcatcagtgggtgtactaccgcctgtaaaatgggatggcttcaggaagaagagcatcctc
agtcctcgcaactctatgggtatcctcagccctgtcacagtgaagattgcaaggcctgac
caccacagtagccccagtgtagaccatttgagttgtgccggactcccgaagagccccgtg
gacccttgctcaagagaaagcgtccttaaggtgttaaaggaaagtcgtaagagaaacgta
gaggatgaagacagaagctttacaactgagcagaggaacaaaagaaggcgtaatgacagt
ggtgggagtgcacactctgcttttgaacctctcttacccaatggaacaccatcacagctg
gttcccaaaccaggaagcctaaaaagaggaatgacctccctgatggaggagtccattatg
aagaggtctcgcacatcctctattagttctggcactggattccatgcaccaagaggaacc
ccaggcaccacacgaaaccccatccacagctcttacagctctacattggggctcagccag
aggaagaaaaggtcagcacccagtcccacgatgtccagccctggatcatctcgctcacag
actccagagggagcctcaaaaagatccagagaggaagaaggacagtctcccagttcagca
tcttctatgaagtcagaccaggcagcctctgagaaagcagctgtaacttctgacctgacc
ccggtccccaaggtcccagtcactacctcaatcaactcaacgggtagtggcgggaaaagg
aaacggaggatccagttgatatccagccacagagatgataacatatctttgcccccacct
ccggaactgggctataccatcactgtgaaggaccttgatgatgagaagaaggctgccatc
aacaagatccagaagatcctggagacacctgagccagagaagtctgtctctccttccgat
accgccctttcccagtggccttctactaactcgaccactacaaccattctgagcagtctg
ctagcagctccattgcccacaacctctgctgctgccatcccagtcatcaatctaaaccca
agccccgtgacgagcgtggctacatccccagcagcctctagcccactgcttgaggctctg
aaaatgaagagcagcactcctattagttctctatctactgtcaactcaactacagttgtg
acaccaccctcactggctaaacccattggcttaaagctgaatgtttcttcagtgactcca
cagttgacacctgtgtcccagcctcagtcctcctctgttggtgtctcgattccctctgcc
tttactcagctgccaagccaggtgtctgtggcgcccagcactgctccgaatgctggaaaa
cctggactttttgggttgttgggccagagtagcacccacacctctgcttccagtcccacc
tctactgttgcctctaccaacagcaactctgcttcagtcactagcaaccctctgttggct
tcagggttcaagcccatcttcgccgtcacgccaacagcgacctcatcaactatgtcgacc
ccggagatcaaacctgtccaaacattcaaacccatctttggcgccaccactgcaggacct
gggtttcagtcttctcccattacagctacaaacccagcttctacactttcttccaacatt
acatcgtctttgtttggctccataagcagcaccacagttgctccatccatgttctcgagc
atgagcagcaccgtcactggcacaacctccgctaactctgtcgccgccacccaaaacgca
aaccagccagctttgaagtcactctttggaaactggaccgcaccaactgcagcaagcacc
agttcagttccagcgctggtccctaatgctggaagcacctttcagtttggggccactacc
accaccgccaacccggctgcagcggcagcagcaacagcgcccgcccccgcccccgccccc
agtgctgctaccacaagctctagcaatggctcctttacatttggagctacacaaccagac
cctcaagctgcaaaacaaaaggtatttgcatttggccaggtggcgccaagccagaataca
actggtgcatcttttggggggtttggcacagtgagcacagctgtcaccacagctcccacc
actgctcagcctgctttcagcttcggaaagtcgtcatttcaagcaccaaccacacagtct
gtgtttggctcgtcattgacacaggcaacatttggctcttcaccgtcacaacctcccaaa
ccgttcccgtttggaggcggcggcacgtcatccacgactgcctcaaatcctgctccatcc
ccattcacctttggagcagctgctgtcaccacgacaaccagctttgtgaccccgactaaa
ccagcgtttggggccaactctactggttttgcatttggcaccagtgcagcagcagcggct
cctgctgcaccgagctttggtgcgtcatctcagactcagagtgccacctctggcacattc
tcatttggtggagccccccctcagcagacgccctctgcccctgctccggcaacacccagt
ggatttaactttggcgctgcagtaactcagtttgggaccccagtttctaataatgctgca
ccgcagatgggaagcttcaactttggggcggctgctgctactgataagccagcatttggc
acacctacaccaaccttcggccaaagtgctgcccaaggtccaataccctttggaactcca
gctcaaggtttcaattctgtaccttttggagcttcaccaactccctctttctccattgga
gctggatcaaaaccctctggggcaagacagaggctgcaggcacggcgacagcacaacagg
aagaagtga

DBGET integrated database retrieval system