KEGG   Takifugu rubripes (torafugu): 101070228Help
Entry
101070228         CDS       T02386                                 

Gene name
sos1
Definition
(RefSeq) son of sevenless homolog 1 (Drosophila)
  KO
K03099  
son of sevenless
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101070228 (sos1)
   04012 ErbB signaling pathway
    101070228 (sos1)
   04630 Jak-STAT signaling pathway
    101070228 (sos1)
   04068 FoxO signaling pathway
    101070228 (sos1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101070228 (sos1)
  Cellular commiunity
   04510 Focal adhesion
    101070228 (sos1)
   04540 Gap junction
    101070228 (sos1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101070228 (sos1)
   04912 GnRH signaling pathway
    101070228 (sos1)
  Development
   04320 Dorso-ventral axis formation
    101070228 (sos1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1106 aa AA seqDB search
MQAAQLQYDFFNEENAPKWRGLLVPSLEKVLNQVHPKLVSQQEALQYIEELILLLLSMLC
QAQPRTVQDVEDRVQKNFPHPIDKWAIADAQAAIEKRKRRNPLALPVEKIHPLLKEILGY
KIDHQVSLYMVAVLEYISADILKLAGNYVKNIRHCEISQQDITVAMCADKVLMDMFHQDE
DVINGFPLIDEEPLVNEEQSYYELVRSFMSDGQIYLRQLNLLILVFREQFTSRPMLFSHH
DVDSIFSRIADIHEVTVKLLGLIEDSVEMTDEDSPHPLVGSCFEDLAEELAFDPYETYAQ
DILHSDFHEHFLSQVSKPSSAVHLQSICEGFKEAVQYVLPRLLLTPVYHCLHMFETLKQL
EEKSQEEEDKECLKQAITALLNLQSSMERICSRSLAKRRLSESACRFYSHQMKGKHLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKLNHGPPRL
PGASSTAEYRLKEKFFMRKVQINDKDDKEGEYRHAFEIILKDGNSVVFAAKSAEEKNSWM
AALISLQYHSTLERMLDSALLREEKEEQMKLPVAEVYRFAEPDSEENVVFEDNVQSKSGI
PIIKAGTVLKLIERLTFHMYADPNFVRTFLTTYRSFCKPQELLDLLMERFEIPEPRPSEL
DQLEGGEQPLSPEVKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDPQLLRTLEEFISS
IRGKTMRKWVESITKIIQRKKQVQVNVPSHSITFQNSPPPTEWHICKPGNIEQFDLMTLH
PIEIARQLTLLESDFFRAVQPSELVGSVWTKEDKELHSPNLLRMIRHTTNLTLWFEKCIV
ETANLEERVAVVSRIIEILQLFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQLTSRQRKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLLRHGKQLINFSK
RRKVAEITGEIQQYQNQPYCLRVDIDIRKFFENLNPTEDVSEKDFSDHLFNKSLEIEPRN
ARTLPRFGKKYSCPLKSPGIRPTSVRSSTMRHPTPLQNEPRKISYSRVPDTEVEGTTVST
PNSPRTXFDSTPCFSHLQHHRPVQCV
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggctcagctgcagtacgacttcttcaatgaggagaacgcaccgaaatggaga
ggcctgctggttccatcactggaaaaggtcctgaaccaggtgcatccgaagctggtgtcc
cagcaggaggcgttgcagtacattgaagagctgatcctgttgttgctcagcatgttgtgc
caggcacaacctcgcactgtacaagatgtagaggaccgagtgcagaagaattttcctcac
ccaatagataagtgggcaattgctgatgctcaggctgccattgagaaaaggaagaggaga
aatccactggctttacctgtagagaagatccaccctttactgaaggagattctgggctat
aagattgaccatcaggtgtcactctacatggttgctgtcttggagtacatctcagccgac
atcctgaagctggcaggaaactacgtgaagaacatcaggcactgtgagatttcccagcaa
gacatcactgtggccatgtgtgctgacaaggttctgatggacatgttccaccaagatgaa
gatgtcattaatggtttccctctgattgacgaagagccattagtcaatgaggagcaaagt
tactatgagcttgtgaggagcttcatgtcagatggacaaatctacttgaggcagctaaat
cttcttattctggtgttcagagaacagttcacctccagaccaatgctcttctcccatcac
gacgtggacagtatcttcagccggattgctgatatccacgaggtgactgttaagctgttg
ggtctgattgaggactctgtggagatgacagatgaagacagtcctcatcctctggttgga
agctgctttgaggatctggctgaggagctggcctttgacccttatgagacttatgcacag
gacatcctgcattctgactttcacgaacacttcctgagtcaggtgtccaaaccaagttct
gctgtccatctccagtccatctgtgaaggttttaaagaagctgttcagtatgtgctgccc
agactgcttctcacaccagtttaccactgtctgcacatgtttgagacactcaagcaacta
gaggagaagagtcaggaggaggaagataaagaatgtctgaaacaggcaatcacagccctt
ctcaacctacagagcagcatggagagaatctgctcacggagcctggccaagaggagactc
agtgaatcggcgtgtcgcttctacagccatcagatgaaggggaagcatcttgccataaag
aagatgaatgagattcagaaaaacattgatggctgggagggaaaggacattggccagtgc
tgcaatgagtttatcatggagggtacactgactcgtgttggagccaaacatgagcgccac
attttcctatttgatggactgatgatctgttgcaagttgaaccatggccctcccagactt
ccaggtgccagttccaccgctgagtaccgcctgaaagagaagtttttcatgcgcaaagtt
cagattaatgacaaagatgataaggagggtgaataccgacatgcttttgagatcatcttg
aaggatggaaacagtgtggtgtttgccgccaaatctgcagaggaaaaaaacagctggatg
gcagcgcttatatcactgcagtaccacagcacactggaacgtatgctggactcggccttg
ctgagagaggagaaggaagagcaaatgaagctgccggtggctgaggtgtaccgatttgcc
gaaccagattctgaggagaatgtggtgtttgaagacaatgttcaatcaaagtcaggaatc
cctatcatcaaagcagggacagtcctgaagctgattgagaggctcaccttccacatgtac
gcagacccaaactttgtccgaacatttctgaccacctacagatctttctgtaagcctcag
gaacttctggacctgctgatggagaggttcgaaattccggagccaagacccagtgagctg
gaccaattagagggtggggaacagccactcagtcctgaagtcaagcgcttccgtaaagag
tttgttcaacccgtccaactgagagtgctgaatgtgtgccggcactgggttgaacatcat
ttctatgactttgagagagaccctcaactgctgaggacattggaggagtttatttcatca
atcagagggaagacaatgaggaagtgggtggagtctatcacaaagattatacagagaaag
aagcaggttcaggtgaatgtgcccagtcatagcattaccttccagaactctccccctcca
actgaatggcacatctgcaaaccaggaaatatagaacagtttgacctgatgacgcttcac
cctattgagattgcacggcagctcacactgctcgagtctgatttcttcagggcagtgcag
ccatctgagttagttggcagtgtttggaccaaagaggacaaagagctccactccccaaac
ctcctgagaatgattcgtcacacgaccaaccttacactgtggtttgaaaagtgtattgta
gaaacggcgaatcttgaggaaagagtagccgttgtctcacggatcatagagatcttgcag
ctttttcaggaacttaacaacttcaatggcgttcttgaggtggtcagcgccatgaattca
tccccagtgtacagactggaccatacctttgagcaactaacaagtcgtcagaggaagatc
ctggaagaagctcatgagctaagtgaagaccactacaagaagtaccttgcaaaactgcgc
tccattaaccctccctgcgtccctttctttggaatatacctgaccaacatcttgaagaca
gaagaaggcaaccctgacttcttgctgcgccacgggaaacaacttatcaacttcagcaag
agaaggaaggtggctgagatcaccggtgagatccagcagtaccagaaccagccctactgc
ctgagagtggacattgacatcaggaagttcttcgagaacctcaatcccacggaggatgtg
agtgaaaaggactttagcgatcatttgttcaacaaatctcttgagattgaacctcggaat
gcacgtacgctgccacgttttggaaagaaatactcctgtccactgaaatctccagggatt
cggccgacctctgtgcgctccagcacaatgcgtcatcccacgccactgcaaaatgagcca
aggaagatcagttacagccgtgtccccgacactgaggtagagggcacaacagtctcaact
cccaactcaccccgcaccncctttgactccaccccctgcttcagccacctccagcaccac
agacctgtgcagtgtgtttga

DBGET integrated database retrieval system