KEGG   Takifugu rubripes (torafugu): 101070248Help
Entry
101070248         CDS       T02386                                 

Definition
early growth response protein 3-like
Orthology
K12497  
early growth response protein 3
Organism
tru  Takifugu rubripes (torafugu)
Brite
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    101070248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 423 aa AA seqDB search
MTGKLAEKLPLTMSSLINTIPDSLYPEEDIPTSMNIFTNTESISHYSQMNSDNIMDLGMG
SEKAAAEIQYGSSFQSNRSAQTVTYLGKFAFDTPPSGGIGGSGWCSDNNIISLVSAGILG
VSPSPGTVTTQTSSAAAAASMGGQTSDMEQVYGPPLPAYSTCSDLYQDQVSFHHSPATST
TLAYPGNDYHSTPKGSMDGSLFSMIPDYNLFHHQGEVGVMEHKPFQTMDPIRVNPPPITP
LETIRAFKDKQQIHPGFISGQQHPPQHHPPPQTLTLKPIRPRKYPNRPSKTPVHERPHAC
PAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEF
CGRKFARSDERKRHAKVHLKQKDKKPAEKSSGAAGSHSSPPSSCGGPAXGNIMTATTGAG
TGP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacagggaaactagcggagaagctccctcttaccatgagcagtttaattaacacgatc
cctgacagtctctatccagaagaggacatcccgacgtctatgaatattttcactaacacg
gaatctatttcccactattcgcagatgaactcagataacatcatggacctgggaatgggc
agtgagaaagcagccgcagagatccagtacggttccagcttccagtccaaccgcagcgct
cagaccgtcacctatctggggaagttcgccttcgacactccgccatcaggagggatcggc
ggctccggctggtgctccgacaacaacatcatcagcctggtcagtgccgggatcttgggc
gtgtctccatcacctggcacagtaacgactcagacttcatcggcggcggcggcagccagc
atgggtggacagacgtcagacatggagcaggtgtacgggccgccgctacctgcctactcc
acctgcagtgacttgtaccaggaccaggtctccttccaccacagccctgccaccagcaca
accctagcctaccctggcaatgactatcactccacacccaaaggttcaatggatggcagc
cttttctccatgatccctgactacaaccttttccaccatcagggggaggttggcgtgatg
gagcacaagcccttccagaccatggaccccatccgtgtgaaccctccccccatcacacct
ctggagaccatcagagcattcaaagacaagcagcagattcacccaggtttcatcagcggg
cagcagcaccctccccagcaccacccgcccccccagactctcaccctcaaacccatccgg
ccgcggaagtatcccaatcggcccagcaaaacccccgtccacgaacggccacacgcctgc
ccggcggagaactgtgaccggcgcttttcgcgctcagacgaactgacgcgtcaccttcgc
atccacacgggtcacaaacctttccagtgccgaatatgcatgcgctccttcagcaggagc
gaccacctgaccacacacatccgcacacacacaggtgagaaacccttttcctgcgagttc
tgtggacgcaagtttgccagaagtgatgaacgaaagagacacgcgaaggtgcatctgaaa
cagaaggacaagaagccggctgagaagagcagcggtgcagcggggagccacagctccccc
cccagctcctgtggggggccggcgngtgggaacatcatgaccgccaccacaggcgctggg
actgggccataa

DBGET integrated database retrieval system