KEGG   Takifugu rubripes (torafugu): 101070282Help
Entry
101070282         CDS       T02386                                 

Definition
neuroendocrine convertase 1-like
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     101070282
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S8: subtilisin family
   101070282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 678 aa AA seqDB search
MAGFMFSALVLVFGCLLQRKPVTTEGHHGTNRHIFYVVQMDRGIRGARVLAQQHGLEFIQ
RVGSLENLYTLRDSRGRPDRATFERNLAAVEGVQWVQRQSSHYRDKRLPARDVRQRSTNS
SWRSEPPADRQPEEKRSDQCLTFNDPLWPMQWELFAQGEYRVGGLDLNVMPVWCHNVTGD
GVVVSIIDDGQEYAPSSSVVKEKGENGGMRAERGIGVQEALASFDVRSAHGLSHDPMPVQ
DELNSHGTRCAGEVAMEANNSYCGVGIAFNARIGGIRLLDGPVTDAMEATALTFNFHFID
IYVCSWGPRDDGATMDGPGVLTEQALWLGTHKGRRGKGSIFVWAAGNGGLQLDHCGADGY
VNSIYNIAIGAVSHAGKPAYFGEPCPGVMAVTLSGARVTVTSSGDGCVEHFQGTSSAAPI
AAGILALVLEVNPELTWRDVQYLIARTAKIPNAMEPGWYINAAGYHVHHRNVLLPAEKAR
LSRSSLVAKLNSHSVRVDISAVCRGDLSVSLESPSGTVSVLLDTRPNDASTAGLKNWTLM
TVHCWEEQPRGLWTLWVTDHKGTAKSCRRHSDEEEAAGALFSATLILFGTYRPHRSTQDG
PLQSVVVMGSRHPVPHIQQKDPTSRPPLGLIQWMNQMERDGAVRADDITVAPRHQGGLFI
QGLKEGQNTPPHHNGGDP
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcttcatgttcagcgcactggtgctggtgtttggctgcttgctgcagaggaaa
ccggtgaccacagaggggcatcatggcaccaatcgccacatcttttatgtggtgcaaatg
gacagaggcatcagaggcgccagagttctggcccaacagcatggactggagttcatacaa
cgggtcggaagcttggagaatctgtacaccttgagagacagcagggggcgccctgacaga
gccacctttgagagaaacctcgcggctgtggaaggggtgcagtgggtgcagaggcagagc
agtcattacagagacaaacgacttcctgccagggacgtcagacagagaagcaccaacagt
tcctggcggagcgagcctccagctgacaggcagccggaggagaagaggagtgaccagtgc
ctcaccttcaatgacccgctctggcccatgcagtgggagctgtttgcacagggggagtac
agagtcggcggcctcgacctgaacgtaatgccagtatggtgccacaacgtcacaggcgat
ggagtggtggtcagcatcatcgacgatgggcaggaatacgcaccgagctccagcgtggtg
aaagaaaagggcgaaaatggggggatgagggcagagagaggcatcggagttcaggaagcc
ctcgccagcttcgacgtgcgttccgcgcacggtctgtctcatgaccccatgcccgtccaa
gacgagctgaatagccacgggacgcgttgcgcaggggaagttgccatggaggccaacaac
tcctactgcggtgtgggcatcgccttcaatgccaggatcggaggtatccgcctgttggac
ggccccgtcaccgacgccatggaggccacggctctgaccttcaacttccacttcatcgac
atctacgtgtgcagctggggcccgcgggacgatggggccacgatggatgggcccggcgtc
ctgacagagcaggccctttggctggggacgcacaagggccgaagaggaaagggcagcatc
ttcgtgtgggcggcaggtaacggaggactgcagttggatcactgcggcgcggacggttat
gttaactccatctacaacatcgccattggcgccgtctctcacgcggggaagcccgcctac
ttcggcgagccctgccctggtgtgatggccgtcactctgtcaggggcccgtgtcacggtt
accagcagcggggacggctgtgtggagcacttccagggaacgtccagtgccgcccccatc
gcggcgggaattctggccctcgtcctcgaagtgaatcctgagctgacatggagagatgtt
cagtatctgatcgccaggacggcgaagatccccaacgccatggagcccgggtggtacatc
aacgccgcgggataccacgttcaccacagaaatgtgctgctccctgctgagaaggcccga
ctatcacgttccagccttgttgctaagctaaacagccattctgtgagggtggacatcagc
gccgtgtgccggggcgacctctccgtgagcctggagtctccatctggcaccgtatcagtg
ctgctggacacgcggcccaacgatgcctccactgccgggctgaaaaactggacgctgatg
acggttcactgctgggaggagcagccacgaggcctctggaccctctgggtgactgaccac
aaaggaacagcgaagagctgcaggaggcatagtgatgaggaggaggcagccggggccctg
ttcagcgctacactcatcctcttcggcacctaccgcccacaccggagcacacaggatgga
cccctgcagagcgttgttgtcatggggtcgcgtcaccccgtccctcacatccaacagaag
gaccccacatcgcgaccccctctgggcttgattcagtggatgaaccagatggagagagac
ggggcggtacgggccgatgatatcaccgttgcacccagacatcagggtggtctcttcatc
cagggcctcaaagagggacagaatacacctcctcaccacaatggaggggacccatag

DBGET integrated database retrieval system