KEGG   Takifugu rubripes (torafugu): 101070454Help
Entry
101070454         CDS       T02386                                 

Definition
transmembrane O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101070454
  Amino acid metabolism
   00350 Tyrosine metabolism
    101070454
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     101070454
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101070454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 261 aa AA seqDB search
MWLVAVSVPLIPVVIVAFSRYGGLFTALCHRALAWTHRVLLRRKVCVRSTHAYVFSNCTH
GKVDSVLETFDLYGNTHPSLSISPQMSAVLDEAVMRVRPSLVLELGMHCGYSSVRLLRLL
PPAGRLVTVEVDPVTAELGEEILLVAGFKHSQFQVLTSSSARAIPTLRPHVGADKGASEG
FGLVLMDHDPQQYLPDLIALEREELLSPSGCTILLINRTQRHGDVGDVVAHVSGRSDFYS
VRSEHCFMVEIVYCRKPTNVL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcgtggcagtttccgtccctctgattcctgtcgtcatcgtggcattcagccgg
tatggtggacttttcacagctctgtgtcatcgagctctggcctggacacatcgggtgctg
ctgcggaggaaagtgtgtgtgaggagcacccatgcctacgtgttctctaattgtacccac
gggaaagttgacagcgtcctggagacctttgacctttatggcaacacacacccatccctc
tctatcagtccccagatgtctgcagtgcttgatgaggctgtgatgcgcgtccgtccctct
ctggtgttggagctggggatgcactgtggctacagctcagtccgcctgctgcgtctgctg
ccccctgctggtagactcgtcacagtggaggtggatccggtcacggcagagttaggggag
gaaatcctcttagtggctggattcaaacactctcagttccaggtgttgacttccagttca
gcccgagccatcccaacattgcgtcctcatgtaggagctgataaaggggccagtgagggg
tttggtctggttctgatggatcatgacccccagcagtaccttcctgacctgatagctcta
gaaagagaggagctcctcagcccctctggatgcaccatcctcctgatcaacaggacacag
aggcatggcgatgtcggagatgttgtggctcacgtcagcgggaggtctgacttctattct
gttagatctgaacattgtttcatggtggagatcgtttactgtaggaagcctacaaatgtc
ctctga

DBGET integrated database retrieval system