KEGG   Takifugu rubripes (torafugu): 101070454Help
Entry
101070454         CDS       T02386                                 

Definition
(RefSeq) catechol O-methyltransferase-like
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
14
AA seq 261 aa AA seqDB search
MWLVAVSVPLIPVVIVAFSRYGGLFTALCHRALAWTHRVLLRRKVCVRSTHAYVFSNCTH
GKVDSVLETFDLYGNTHPSLSISPQMSAVLDEAVMRVRPSLVLELGMHCGYSSVRLLRLL
PPAGRLVTVEVDPVTAELGEEILLVAGFKHSQFQVLTSSSARAIPTLRPHVGADKGASEG
FGLVLMDHDPQQYLPDLIALEREELLSPSGCTILLINRTQRHGDVGDVVAHVSGRSDFYS
VRSEHCFMVEIVYCRKPTNVL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcgtggcagtttccgtccctctgattcctgtcgtcatcgtggcattcagccgg
tatggtggacttttcacagctctgtgtcatcgagctctggcctggacacatcgggtgctg
ctgcggaggaaagtgtgtgtgaggagcacccatgcctacgtgttctctaattgtacccac
gggaaagttgacagcgtcctggagacctttgacctttatggcaacacacacccatccctc
tctatcagtccccagatgtctgcagtgcttgatgaggctgtgatgcgcgtccgtccctct
ctggtgttggagctggggatgcactgtggctacagctcagtccgcctgctgcgtctgctg
ccccctgctggtagactcgtcacagtggaggtggatccggtcacggcagagttaggggag
gaaatcctcttagtggctggattcaaacactctcagttccaggtgttgacttccagttca
gcccgagccatcccaacattgcgtcctcatgtaggagctgataaaggggccagtgagggg
tttggtctggttctgatggatcatgacccccagcagtaccttcctgacctgatagctcta
gaaagagaggagctcctcagcccctctggatgcaccatcctcctgatcaacaggacacag
aggcatggcgatgtcggagatgttgtggctcacgtcagcgggaggtctgacttctattct
gttagatctgaacattgtttcatggtggagatcgtttactgtaggaagcctacaaatgtc
ctctga

DBGET integrated database retrieval system