KEGG   Takifugu rubripes (torafugu): 101070521Help
Entry
101070521         CDS       T02386                                 

Gene name
dyrk1a
Definition
(RefSeq) dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101070521 (dyrk1a)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   101070521 (dyrk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 744 aa AA seqDB search
MMMHPGGETSACKPSSVRLAPSFSLHTAGLQMAAPMPHTHQQYSDRHQPSTDQSVTVLPY
SDQTPQLTANQRHMPQCFRDPTSAPLRKLSIDLIKTYKHINEVYYAKKKRRHQQGQGEDS
SHKKERKVFNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAI
KIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYD
LLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVD
FGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEV
DQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSVKKTKDGKRYKPPASRKLHSILG
VETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFFKKTADEGTN
TSSSVSTSPALEQSQSSGTTSSTSSSSGGSSGTSTSGRARSDPTHHHLHSGGHFGTALPA
IDGDSLCPQTRQPYPPPLVWGGGVGPEPVAGETHPVQETTFHVPPQHPKALHPHSHTHHH
HGQMMATRPRPRHYTSPTHSSSTQDSMEVVHGHLSMTSLSSSASSSSTSSSSTGNHGNQA
YQLRHLPAGALDFGQNGGLSMGLGAFSNPRQETGMAAHPAFAMGTNTGPAHYLAEGHLGM
RQGMDREESPMTGVCVQQSSMASS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcatccaggaggagagacttcagcatgcaaaccttcgtccgtccggcttgcg
ccctctttttctttacacactgctggtcttcagatggctgctccaatgccccatacgcac
cagcagtacagtgaccgccaccagccaagcactgaccaatctgttacggttttaccgtac
agcgaccagacaccacagctcactgccaatcagaggcacatgccccagtgctttcgtgac
ccaacttcagctcccctgaggaagctttccattgaccttatcaaaacatacaaacacatc
aatgaggtgtattatgcaaaaaagaagcgacgccaccaacagggtcagggtgaagactcg
agtcacaaaaaagaaaggaaagtttttaacgatgggtacgacgatgataactatgattac
atcgtcaagaatggggagaagtggatggaccgctatgagatcgactccttgataggaaaa
ggatcatttggacaggttgtgaaagcatacgaccgtgctgagcaggaatgggttgctatt
aagatcatcaaaaacaagaaggctttcctgaaccaagcccagattgaagtgcgcctccta
gagcttatgaacaaacatgataccgagatgaaatattacatcgttcacctaaagagacac
ttcatgttccgtaaccatctctgcctcgtgttcgagatgctttcatataacctgtacgac
cttctacgaaataccaacttccgtggcgtctcactcaacctcacccggaagtttgcccag
cagctatgcacagcgctgcttttcttggccacgcctgagctcagcatcatccactgtgac
ctgaagcccgagaacatcctcctctgtaaccctaagaggagtgccatcaaaatagtggac
tttggcagctcctgccaactgggacaaaggatataccagtatatccagagtcgcttctac
cgttctcctgaggtgctgctgggaatgccctatgacctggccattgacatgtggtccctg
ggttgcatcttggtagagatgcacactggagaacctctcttcagtggagccaatgaggtg
gaccagatgaacaaaatagtcgaggttcttggtatcccacctaatcacataatggaccta
gccccaaaagccaggaagttctttgagaagctttcggatggtacatggagtgttaagaag
accaaagatggtaaaaggtataagcctccagcctcacggaagctccactccatcttgggt
gtggagacagggggtccaggtggccggcgggctggggagtctggccatgctgttgctgac
tacttgaagttcaaggacctgatcctacggatgttggactatgaccctaaaagccgcatc
cagccctactatgccctgcagcacagcttcttcaagaagactgcggacgaggggaccaat
acaagcagtagcgtgtctacgagccccgcgttagagcagtcccagtcatcaggaaccacc
tctagcacctcctcaagttcaggaggctcatctgggacaagtaccagtggcagagcaaga
tctgatccgacccatcaccacttgcacagtggaggacattttggcacggccctgcctgcc
attgatggtgacagcctctgtccccaaacaagacagccttacccacccccactggtgtgg
ggaggtggcgttggaccagagcctgtcgctggagagacccacccggtccaggagacaact
ttccacgtgccccctcagcaccctaaggccctgcatccccactcacatactcatcaccac
cacgggcaaatgatggcgacgcggccacgcccacgccattacacctccccgacacacagc
tcctcgacacaggactccatggaggtcgttcatggccatctgtccatgacctccctgtct
tcctctgcctcctcttcctctacatcgtcctcttccactgggaaccatggcaaccaagcc
taccagcttcgccatttgcctgctggagcacttgactttggtcagaatggtgggctgagt
atggggctaggtgccttctcgaacccacggcaggagactggcatggcagcacatcctgcg
ttcgccatgggcacgaacacggggcctgcccactacctagcggaaggtcacctgggcatg
aggcaaggcatggaccgggaggagtctccaatgactggagtgtgtgtgcagcagagttct
atggccagctcgtga

DBGET integrated database retrieval system