KEGG   Takifugu rubripes (torafugu): 101070522Help
Entry
101070522         CDS       T02386                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101070522
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101070522
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101070522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 689 aa AA seqDB search
MAASEDNVTIPEFSCLLQMDPSLKTYEKDFKRRYELLQKHLSQLEEAEGGFDQFTRSYRS
FGVQRLPDNSLFFKEWAPAAEALFLTGDFNGWDKFSHPYIKKDFGKWELTLPPRHDRSPA
VDHGTKLKVVVHTKQGERLYRISPWAKYVTREEKSVIYDWVHWDPPHPYIQIHPRPKKPS
SLRIYEAHVGIASPEGKIASYTNFTTNVLPRIKDLGYNCIQLMAIMEHAYYASFGYQVTS
FFAASSRYGTPEELKQMIDVAHSMGIMVLLDMVHSHASKNSEDGLNFFDGSDSCFFHSPP
RGEHSLWDSRLFNYSSWEVLRFLLSNLRWWMEEYRFDGFRFDGVTSMLYHHHGIGAGFSG
DYSEYFGLQVDEDSVVYLMLANHILHTLYPDCITVGEDVSGMPALCRGVEEGGLGFDYRL
AMAIPDKWIQILKELKDEDWDMGNIVHTLTNRRYGEKCIAYAESHDQALVGDKTLAFWLM
DKEMYTNMSSMIPMTAVIDRGMQLHKMIRLLTHGLGGEGYLNFIGNEFGHPEWLDFPRKG
NNQSYHYARRQFNLVETDHLRYHQLYSFDRDMNRTEDKYGWLAAPPAFISAKHEEDKVIV
FDRANVLFIFNFHPTKSFQDYRVAVEAPGKYKIKLDSDDARYGGHGRLDHSTEFFTEPKA
FNGRPNSVQVYIPCRTAIVLANEEIDYCY
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctccgaggataatgttacaattccagagttcagctgtctgctccaaatggat
ccctctttaaaaacatacgagaaggacttcaagaggaggtatgagctgctacagaagcac
ctttcccagctggaagaggcagagggaggcttcgaccagttcacgcgcagctacaggtcc
ttcggggtgcagcgtctgcctgacaacagcctgttttttaaggagtgggctccagctgca
gaggctctcttcctcaccggtgatttcaatggatgggacaaattctctcacccctacatc
aagaaagattttggcaaatgggagctgactctgccgcccaggcacgacaggtctccagct
gtggaccatggcaccaaactcaaggtggtcgttcacaccaagcagggcgagcggctctat
cggatatctccatgggccaaatatgtaaccagggaagaaaaatccgtcatctatgactgg
gttcattgggatcctcctcatccatacattcaaatccaccctcggccaaagaagcccagc
agcttgaggatctacgaggcccacgtcggcattgcttcacctgaagggaagatcgcctca
tacacaaacttcacaaccaatgtgctgcctcggatcaaagacctgggttataactgtatt
cagctgatggccatcatggaacacgcctactatgcaagctttggataccaggttacaagt
ttctttgcagcttccagtcgctacggtaccccagaggagctaaagcaaatgatcgacgtg
gctcattcgatgggcatcatggtgttgctggacatggttcacagccatgcctccaagaac
tcggaggacggcctgaacttcttcgacgggtccgactcctgtttcttccattctccaccc
agaggagagcacagtctctgggacagccgcctcttcaactactccagttgggaagtgttg
cggttcctgttgtctaacttgcgctggtggatggaagagtaccgctttgatggcttcagg
ttcgacggcgtgacttcgatgctgtaccatcaccacggcatcggcgctggattctcaggg
gactatagcgagtactttggcctgcaggtagatgaagactcggtggtttacctcatgctt
gccaatcacattcttcatacactttatcccgactgcatcaccgttggagaggatgtgtca
ggcatgccggctctctgcagaggagtggaagagggagggctgggctttgattatcgactg
gccatggcaattcctgacaagtggattcagatcctgaaggagttaaaggacgaggactgg
gacatgggcaacatcgtccacacgctgaccaacaggcgctatggggagaaatgcatcgcc
tatgcagagagtcacgatcaagctctggtcggggataaaactctggccttctggttgatg
gacaaggagatgtacaccaatatgagttccatgataccgatgacagcggtcattgaccgc
ggcatgcagcttcataagatgattcgactcctcactcatggcctgggcggagaaggctac
ctcaacttcattgggaatgagtttggacaccctgagtggttggatttccctagaaagggg
aacaatcagagttaccactacgcccggagacagtttaaccttgtggagacggaccacctc
cgttaccaccagctctactcctttgaccgggacatgaaccgcaccgaagacaagtacggc
tggctggccgctccaccggcttttatcagcgccaagcacgaagaggacaaggtcattgtg
tttgaccgggccaacgtgctcttcatcttcaacttccaccccaccaagagcttccaggac
tacagggttgctgtagaagctccaggaaaatacaaaatcaagctggattcagatgatgct
cggtatgggggtcacgggcggctggaccacagtacggagttcttcacggaacccaaagct
ttcaacgggcgcccaaactccgtgcaggtctacatcccctgcagaacagccattgtcctg
gccaacgaggagatagattactgttattag

DBGET integrated database retrieval system