KEGG   Takifugu rubripes (torafugu): 101070611Help
Entry
101070611         CDS       T02386                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:tru00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tru00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 264 aa AA seqDB search
MWLTLLYSCSGGAALLYILYRWVIPSIVQYHAGLALMWHDVIVERLLDVLTRSTRPQRLL
AAVQKNATRGDPRSVVKAIDEFCRYTEWAMNVGDEKGCILDSVVSEVNPATVLELGTYCG
YSTVRIATLLPPDAKLITLEFNPDFAVIARQVIAWAGQEEKVHLVEGSSGDLIPKMKEQF
GVKSFDLVFLDHWKDRYLPDAKLMEECGLLGKGSVLLADNVICPGSPDYLDYVRNSPKYR
SQYFKSHLEYTKVEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgacgcttctctacagttgcagcggcggcgcagctctcctgtacattctgtac
agatgggttataccgtccatcgtgcagtatcacgcagggctggcgctcatgtggcacgac
gtcatcgtggagaggttgctggatgttctgacccgatccacccgtccgcagaggctgttg
gctgcagtacagaagaacgccactagaggggaccctcgcagcgtggtcaaagccatcgat
gagttctgcagatacacagagtgggccatgaatgtgggggacgaaaaaggctgcattctg
gactcagtggtgtcagaggtaaatccagccaccgtgttggagctgggcacctactgtggt
tactccacagtgcggatcgccacgctccttccccctgatgcgaagctcatcactcttgag
ttcaacccagactttgctgtgattgcccgtcaagtcattgcctgggcggggcaagaggaa
aaggttcacctagtcgaaggttcctctggtgacttgattcccaaaatgaaggagcagttt
ggggtgaaatcctttgacctggttttcctggatcactggaaggatcggtacctccctgac
gcaaagctcatggaggaatgtggccttctcgggaaaggcagcgtccttctggccgacaac
gtcatctgtcccggaagtcccgattacctggattatgtccggaacagcccgaaatacaga
agccagtatttcaagtctcacctggagtacaccaaagtggaggatggcttagagaaatct
gtgttcttgggctaa

DBGET integrated database retrieval system