KEGG   Takifugu rubripes (torafugu): 101070634Help
Entry
101070634         CDS       T02386                                 

Definition
histone-lysine N-methyltransferase SUV39H1-like
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tru00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 406 aa AA seqDB search
MPPEQLEDLCRRERLHCRDLGVSRANINHYEVEFLCDYKKTKVGHQQSNTVQQLYMVKWK
GYPESENSWEPKKNLKCPKLMKQFHLDLDQMLRRNKRHSVPKKLDKETVSFLTQKAKLHL
SLQRWEAHLNQTRNHPGRIFVRNEVDLEGPPKNFTYINNYRVGPGIVLDEMAVGCECSSC
WEEPVNGCCPGASLHRMAYNDRGQVRIRPGKPIYECNSQCKCGPECPNRVVQKGIQFDLC
IFKTDNGRGWGVRTLQHIKKNTFVMEYVGEIISTDEAERRGHVYDRQGSTYLFDLDYVED
VYTVDAAHQGNVSHFVNHSCNPNLQVFNVFVDNIDERLPRIALFSTRSIRAGEELTFDYK
MQIDPVDTESTKMDSSFGLAGLTSSPKKRIRVECRCGSDSCRKYLF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggagcagctggaggacctgtgccgcagggagaggctccactgtcgggacctc
ggcgtcagcagagccaacatcaaccactatgaggtggaattcctttgtgactacaagaag
accaaagtaggacaccagcagtccaacacggtgcagcagttatatatggtgaagtggaag
ggatatcccgagtctgaaaactcctgggaacccaagaaaaacttaaaatgcccaaaacta
atgaagcagttccatctggacctggatcagatgttaaggcgcaacaagagacacagcgtt
cccaaaaaactggataaggagacggtgtccttcttgacccagaaagccaaactccacctg
agtcttcagcgctgggaagctcacttgaatcagactcgcaaccatccgggccgcattttc
gtccggaatgaggtggacctggagggcccgccaaagaacttcacgtacatcaacaactac
agagtgggtccgggcatcgtgctggacgagatggcggtgggctgcgagtgtagcagctgc
tgggaggagcccgtcaacggctgctgccccggcgcctccctccaccgcatggcttacaac
gaccggggccaggtccggatccggcccgggaagcccatatatgagtgcaactcgcagtgc
aaatgtggccccgagtgtccaaacagggtggtccaaaagggaatccagttcgacctgtgt
atctttaagactgacaacggtcgaggctggggggtccgcactctgcagcacatcaagaag
aacacgtttgtcatggagtatgtgggagagatcatctccacggatgaagcagagaggaga
ggccacgtgtacgaccgccaaggctccacctacctgtttgacctggactacgtagaagac
gtgtacacggtggatgcagctcaccaaggcaacgtctcccacttcgtcaaccacagttgt
aatcccaacctgcaggtatttaatgtgttcgttgacaacatcgacgagcggctccccaga
atcgccttgttttccacgcgcagtattcgtgcaggagaggagctgaccttcgattacaag
atgcagattgacccagttgacactgaaagcaccaaaatggactccagttttggtctcgcg
ggtctcacgagttctccgaaaaagaggattcgggtggaatgtcgatgtggctcggactcc
tgtcggaaatacctgttctga

DBGET integrated database retrieval system