KEGG   Takifugu rubripes (torafugu): 101070634Help
Entry
101070634         CDS       T02386                                 

Gene name
suv39h1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1 (Drosophila)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101070634 (suv39h1)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101070634 (suv39h1)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101070634 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101070634 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 416 aa AA seqDB search
MAENLKEAAAAGCSVPCKMPPEQLEDLCRRERLHCRDLGVSRANINHYEVEFLCDYKKTK
DTELYMVKWKGYPESENSWEPKKNLKCPKLMKQFHLDLDQMLRRNKRHSVPKKLDKETVS
FLTQKAKLHLSLQRWEAHLNQTRNHPGRIFVRNEVDLEGPPKNFTYINNYRVGPGIVLDE
MAVGCECSSCWEEPVNGCCPGASLHRMAYNDRGQVRIRPGKPIYECNSQCKCGPECPNRV
VQKGIQFDLCIFKTDNGRGWGVRTLQHIKKNTFVMEYVGEIISTDEAERRGHVYDRQGST
YLFDLDYVEDVYTVDAAHQGNVSHFVNHSCNPNLQVFNVFVDNIDERLPRIALFSTRSIR
AGEELTFDYKMQIDPVDTESTKMDSSFGLAGLTSSPKKRIRVECRCGSDSCRKYLF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagaagcggctgctgctgggtgcagcgtcccctgcaagatgccc
ccggagcagctggaggacctgtgccgcagggagaggctccactgtcgggacctcggcgtc
agcagagccaacatcaaccactatgaggtggaattcctttgtgactacaagaagaccaaa
gacacagagttatatatggtgaagtggaagggatatcccgagtctgaaaactcctgggaa
cccaagaaaaacttaaaatgcccaaaactaatgaagcagttccatctggacctggatcag
atgttaaggcgcaacaagagacacagcgttcccaaaaaactggataaggagacggtgtcc
ttcttgacccagaaagccaaactccacctgagtcttcagcgctgggaagctcacttgaat
cagactcgcaaccatccgggccgcattttcgtccggaatgaggtggacctggagggcccg
ccaaagaacttcacgtacatcaacaactacagagtgggtccgggcatcgtgctggacgag
atggcggtgggctgcgagtgtagcagctgctgggaggagcccgtcaacggctgctgcccc
ggcgcctccctccaccgcatggcttacaacgaccggggccaggtccggatccggcccggg
aagcccatatatgagtgcaactcgcagtgcaaatgtggccccgagtgtccaaacagggtg
gtccaaaagggaatccagttcgacctgtgtatctttaagactgacaacggtcgaggctgg
ggggtccgcactctgcagcacatcaagaagaacacgtttgtcatggagtatgtgggagag
atcatctccacggatgaagcagagaggagaggccacgtgtacgaccgccaaggctccacc
tacctgtttgacctggactacgtagaagacgtgtacacggtggatgcagctcaccaaggc
aacgtctcccacttcgtcaaccacagttgtaatcccaacctgcaggtatttaatgtgttc
gttgacaacatcgacgagcggctccccagaatcgccttgttttccacgcgcagtattcgt
gcaggagaggagctgaccttcgattacaagatgcagattgacccagttgacactgaaagc
accaaaatggactccagttttggtctcgcgggtctcacgagttctccgaaaaagaggatt
cgggtggaatgtcgatgtggctcggactcctgtcggaaatacctgttctga

DBGET integrated database retrieval system