KEGG   Takifugu rubripes (torafugu): 101070781Help
Entry
101070781         CDS       T02386                                 

Definition
prostaglandin G/H synthase 1-like
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101070781
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101070781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 617 aa AA seqDB search
MKAFISFPACMLVNLLLLLESMSSTGDSNSVNPCCYYPCQNAGVCVRFGTDQYQCDCTGT
GFYGDNCTVPEFWTKVYILFKPSPAVVHFILTNFHWFWGLVNNSLLQDIFMRFVLTVRIN
LVPDIPTYNTKYGYLNWESYYNISYYTRLLPPVPEDCPLPMGTKGKAVLPDPDVLLEKFF
KRRVFKPDPQGTNLMFAFMAQHFTHQFFKTHPGVGGGFTKALGHGVDGSHIYGDNLMRQF
QLRQQKDGKLKYQLINGEMYPPTVSNVPVDMRYPPTIPPEHRLAIGNELFGLVPGLSMYA
TIWLREHNRLCDILKEEHPTWDDEQLFQTARLIVIGETIKIIIEEYVQHLSGYLFKLKFD
PSLLFKEQFHYSNRIAVEFVHLYHWHSLMPDSFLIDGDDVPYSQFLHNNSLLIHYGVEKL
VDSFSRQPAGQIGGGQNFNEHILGVIKSLFRESRADRLRPFNEYRKKFDLKPYSSFSELT
DNVEIARDLEELYGDIDALEFYPGLILEKTHSNSIFGESMVEMGSPFSLKGLFGNPICSP
EYWKPSTFGGETGFNIVKTATLRKLVCLNTKWCPYVSFNVPDFVRGGLKTGEANEVECVT
ELVWVLVPAAVVTVAVG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttatcagcttccctgcctgcatgctcgtaaacctgctgctgctgctggag
agcatgtcatcaactggtgactcaaattctgtgaatccctgctgttattacccctgtcag
aatgcaggcgtgtgtgtgagatttggtacagaccaatatcagtgtgactgcactggcacc
ggcttctatggagacaactgcactgtccctgaattttggaccaaggtttatatcctgttt
aagccaagtcctgctgtggttcacttcatcctcacaaattttcactggttctggggcctt
gtcaacaactctttgctgcaagacatatttatgcgatttgtgctgacagtccgaatcaac
ctggttcccgacattccgacctacaacaccaaatacggatacctcaactgggagtcctac
tacaacatatcctactacacccgactcctcccaccggtacctgaagactgtcctctgccc
atggggactaaaggaaaagctgttcttcctgatcctgacgtgttgcttgagaagtttttc
aaaagaagggtcttcaaacctgaccctcaaggaacaaatctaatgtttgccttcatggcc
caacacttcacccatcagtttttcaagacacatcctggagttggaggtggtttcaccaaa
gctttaggacacggggttgacgggagtcatatttatggagacaacctcatgcgacagttt
caacttcgtcaacaaaaagatggaaagttgaagtatcagttgataaatggagaaatgtac
cctcctacagtaagcaatgttcctgtggacatgaggtatcctccaactatccctccagag
caccgcctggctattggtaatgagttatttggtcttgtgccgggtctctccatgtacgcc
accatatggctgagggagcacaacagactgtgtgacatcttaaaggaagaacaccccacc
tgggacgatgagcagctctttcagacagccaggctcatcgtcattggagaaacaattaag
ataataattgaagaatacgtgcaacatctaagtggttatttgttcaagttgaagtttgat
ccttccctgctcttcaaagagcagttccactacagcaatcgcatcgctgtggagtttgtc
cacctttaccactggcactctctgatgcccgacagcttcctcatcgatggagacgacgtc
ccatactcccagtttctccacaacaattccctcctcatccactacggggtggagaaattg
gtggattccttttctcgacagccggctggacagataggcgggggtcaaaacttcaatgaa
catatactgggagtcataaagtcgctcttcagagagtctcgggcagatcgtctgcggcca
tttaatgaatatcggaagaaatttgacctcaagccatactcgtcatttagtgaactgact
gacaacgtagaaattgccagagatttggaggaactgtacggtgacatagatgccttagaa
ttttaccctgggctgatactggagaaaacacactctaacagcatatttggagagagtatg
gtggagatgggctctcctttctccctcaaaggcctgtttggaaatcccatctgctcccca
gagtactggaagcccagcacctttgggggagagacaggcttcaatatcgtcaaaacggcc
actttaaggaaactggtgtgtctcaacaccaagtggtgtccatacgtgtcctttaatgtt
cccgactttgtaagaggcgggctgaagacaggggaagccaatgaggtggaatgtgtcact
gaattagtttgggtgctggtgcccgctgctgttgtaacagtggctgttgggtaa

DBGET integrated database retrieval system