KEGG   Takifugu rubripes (torafugu): 101070842Help
Entry
101070842         CDS       T02386                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    101070842
  Replication and repair
   03420 Nucleotide excision repair
    101070842
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101070842
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     101070842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 319 aa AA seqDB search
MFHNSSHKRFWIFKSEDELEHMRCKANQKFRNKILESGKSGANESIFLERNEEDVLFRYY
ERRMLDFCNAFKPAMPKSVVGTGIMYFRRFYLNNSIMEYHPRIIMLTCAYLSCKVDEFNV
SSTQFVGNLVQESPAGQERVLEQILEYELLLIQQLNFHLVVHNPYRPLEGLLIDLKTRFP
TLENPESLRKSSDDFLTQAAITDAGLLFPPSQIALAAILNSALRAGLNLESYLTECLGLK
GDKEMLAKMYDSLRRIKILLKKYELPKAEEVNLYKHKLERNHAEFSTSSNKRKRGYEEDG
HVAKEPRLTEEEWTDEDLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttccacaacagttcccacaaaaggttctggatctttaaaagtgaggatgagctggag
catatgcgctgcaaagcgaaccagaaattccgcaataagatcctggagagtgggaagtct
ggagccaatgaatccatatttctggagcggaatgaagaagacgttttattcagatactac
gagaggagaatgctggatttctgtaacgcatttaaaccagcaatgcccaaatctgtcgtg
ggtacagggatcatgtacttcagaagattctacctgaacaactccatcatggaataccat
cccaggattatcatgttgacgtgtgcgtacctgtcctgtaaagtggatgagttcaatgtg
tccagcacccagtttgtgggcaacctggttcaggagagcccggcggggcaggagagggtt
ctggagcagatcctggagtacgaacttctgctcatccaacagctcaactttcacctggtc
gtccacaacccctacagacccctggaggggctgctcattgacctcaagacacggttccct
acgctggagaacccagaatcgttgaggaagagctctgacgactttctgactcaggcagcc
atcaccgacgcgggactgctgttccctccgtctcagatcgccctggcagccatactcaac
agcgccttaagagccggtctcaacttggagagctacctgacagaatgtttggggttgaag
ggagataaagaaatgctcgcaaagatgtatgattcactacgacggataaaaatcctctta
aagaaatatgaacttcccaaggcagaggaggtaaacttatacaagcacaagctggagagg
aaccatgctgaattttccacatcgagcaataaaagaaaacgagggtacgaggaggacggc
cacgtcgccaaagaaccacgtctgacagaagaggagtggaccgatgaagacctgatttag

DBGET integrated database retrieval system