KEGG   Takifugu rubripes (torafugu): 101070909Help
Entry
101070909         CDS       T02386                                 

Gene name
kat2b
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101070909 (kat2b)
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101070909 (kat2b)
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101070909 (kat2b)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101070909 (kat2b)
   HAT complexes
    PCAF complex
     101070909 (kat2b)
    STAGA complex
     101070909 (kat2b)
    TFTC complex
     101070909 (kat2b)
    SAGA complex
     101070909 (kat2b)
    SLIK complex
     101070909 (kat2b)
    ADA-HAT complex
     101070909 (kat2b)
    HAT-A2 complex
     101070909 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 792 aa AA seqDB search
MADGAGIQQGSPAIGAAGLVPAGPGAGGTEGSGTAGGSARIAVKKAQLRSSPRPKKLEKL
AVYSSCKAEGACKCNGWKSQNPPPTPPRTDQQSSAVNLQEPCRSCSHTLGDHVTHLENIS
EEEMNRLLGIVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
ERPSIEQGVNNFVQYKFSHLPSKERQTITELSKMFLNQINYWQLETPSQRRQRVSSDDAA
GYKANYTRWLCYCNVPQFCDSLPRYQTTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHNSPIWSQDFLAGVSGGQIPVHTVISAPPVVIPLYYS
PSPVSVDPSMCGSVSPARKAASVLEPSPVGEKRKPTEPLHHEENKRPRVLGDIPMDLINE
VMATIADPAAIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQI
PIESIPGIRETGWKPVGKGKELKDPDQLYSTLKTILQHVKMHQNAWPFMEPVKKTEAPGY
YQSIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFF
YTKIKEAGLIEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggcgctgggatacagcagggttcgccggccatcggggccgcggggttggtt
ccggccggtcccggtgccggggggacggagggctctggcaccgctggaggatccgcacgt
atcgccgtgaagaaggcgcaactccgctcctcacctcggccaaagaagctggaaaaactc
gccgtgtattcctcctgcaaggctgagggagcctgtaagtgtaatggctggaaaagccaa
aacccccctccgacccccccacgaaccgaccagcagtccagcgcggtcaacctgcaggag
ccctgccggagctgctctcacacgctgggtgatcatgtgacccatctggaaaacatttct
gaggaggaaatgaacagacttctaggtatcgtcctggatgtagagtatctctacacgtgc
gtacacaaagaggaggatgcagacaccaaacaggtctacttttcactcttcaaattgttg
aggaagtccatcctgcagatgggtaaaccgatgttagaagcccaggagagtcctccgttt
gaaaggccaagcattgagcagggggtcaacaactttgtccagtacaagttcagccacctt
ccctcgaaagagcgtcaaaccatcacggagctctccaagatgtttctcaaccagatcaac
tactggcagctggagacgccctcccagaggcgccagagggtctccagtgacgacgcggcc
ggatacaaagccaactacaccaggtggctgtgctactgcaacgtgcctcagttttgcgac
agcctccctcgctaccagaccacgcagatcttcggccggactctgctgcgctccgtcttc
accgtgatgaggaaacaactgctcgagcaggccagacaggaaaaggacaagctgccgcct
gagaagcgtacactcatcctaacacactttcccaagttcttatcgatgctggaggaggaa
gtgtacagccataattcccccatctggagccaagacttcctggcaggagtgtcagggggg
cagattcctgttcacacagtcatcagcgcgcccccagtggtcataccgctatactacagc
cccagtcccgtgtctgtggatccctccatgtgtgggagcgtcagtcccgccaggaaagca
gcttctgtgctggagccaagtccagttggagaaaagcgcaaacccacggagcctctccac
cacgaggagaacaagagacccagggtgttgggtgacatccccatggacctcatcaacgaa
gtcatggcaaccatcgcggatcccgctgccattccagagaccagtctgctgtcggctcac
tctgcgcgtgacgaagccgcccgtctggaggagcgcaggggcgtgatcgaattccatgtc
atcggtaactccctgaaccagaagcccaataagaggatcttgatgtggctcgtcggcctc
cagaacgtcttctctcaccagctgccccgcatgcccaaggagtacatcacacgactggtc
tttgacccgaagcacaagacgctgtcgctgatcaaggacggacgggtgatcggggggatc
tgcttccgcatgttcccgtcccaagggttcaccgagatcgtcttttgcgccgtgacgtcc
aacgagcaagtgaagggctacgggacccacttgatgaaccacctgaaagagtatcacata
aagcacgagatcctcaatttcctcacctacgctgacgagtacgccatcggctacttcaaa
aaacagggtttttcaaaggatatcaaggtacccaaggccaaatacgtgggctacatcaaa
gattatgagggggccacactgatgggctgtgagctcaaccccagtattccttatacagag
ttctctgtcatcatcaagaagcagaaggagatcatcaagaagctgatagagaggaagcag
gctcagatccggaaagtttacccggggctctcgtgctttaaagaaggcgttcggcagatc
cccatcgaaagcattcccggcatccgtgaaactggctggaagcctgtcggcaaagggaag
gaactgaaggatccagatcagctgtacagcactctgaagaccatccttcagcatgtaaag
atgcaccagaatgcctggcctttcatggagccggtcaagaaaacagaggcccctgggtac
taccagtccattcgcttccccatggacctcaaaacgatgagcgagcgtttgaaaagcagg
tactacaccacgcgcaagttgttcatggccgacatgcagcgcatcttcactaactgccgt
gaatacaacccccccgagagcgagtactacaagtgcgccaacctactggagaagttcttc
tacaccaagattaaagaggcaggcctgattgagaagtaa

DBGET integrated database retrieval system