KEGG   Takifugu rubripes (torafugu): 101070909Help
Entry
101070909         CDS       T02386                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:tru04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 792 aa AA seqDB search
MADGAGIQQGSPAIGAAGLVPAGPGAGGTEGSGTAGGSARIAVKKAQLRSSPRPKKLEKL
AVYSSCKAEGACKCNGWKSQNPPPTPPRTDQQSSAVNLQEPCRSCSHTLGDHVTHLENIS
EEEMNRLLGIVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
ERPSIEQGVNNFVQYKFSHLPSKERQTITELSKMFLNQINYWQLETPSQRRQRVSSDDAA
GYKANYTRWLCYCNVPQFCDSLPRYQTTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHNSPIWSQDFLAGVSGGQIPVHTVISAPPVVIPLYYS
PSPVSVDPSMCGSVSPARKAASVLEPSPVGEKRKPTEPLHHEENKRPRVLGDIPMDLINE
VMATIADPAAIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQI
PIESIPGIRETGWKPVGKGKELKDPDQLYSTLKTILQHVKMHQNAWPFMEPVKKTEAPGY
YQSIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFF
YTKIKEAGLIEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggcgctgggatacagcagggttcgccggccatcggggccgcggggttggtt
ccggccggtcccggtgccggggggacggagggctctggcaccgctggaggatccgcacgt
atcgccgtgaagaaggcgcaactccgctcctcacctcggccaaagaagctggaaaaactc
gccgtgtattcctcctgcaaggctgagggagcctgtaagtgtaatggctggaaaagccaa
aacccccctccgacccccccacgaaccgaccagcagtccagcgcggtcaacctgcaggag
ccctgccggagctgctctcacacgctgggtgatcatgtgacccatctggaaaacatttct
gaggaggaaatgaacagacttctaggtatcgtcctggatgtagagtatctctacacgtgc
gtacacaaagaggaggatgcagacaccaaacaggtctacttttcactcttcaaattgttg
aggaagtccatcctgcagatgggtaaaccgatgttagaagcccaggagagtcctccgttt
gaaaggccaagcattgagcagggggtcaacaactttgtccagtacaagttcagccacctt
ccctcgaaagagcgtcaaaccatcacggagctctccaagatgtttctcaaccagatcaac
tactggcagctggagacgccctcccagaggcgccagagggtctccagtgacgacgcggcc
ggatacaaagccaactacaccaggtggctgtgctactgcaacgtgcctcagttttgcgac
agcctccctcgctaccagaccacgcagatcttcggccggactctgctgcgctccgtcttc
accgtgatgaggaaacaactgctcgagcaggccagacaggaaaaggacaagctgccgcct
gagaagcgtacactcatcctaacacactttcccaagttcttatcgatgctggaggaggaa
gtgtacagccataattcccccatctggagccaagacttcctggcaggagtgtcagggggg
cagattcctgttcacacagtcatcagcgcgcccccagtggtcataccgctatactacagc
cccagtcccgtgtctgtggatccctccatgtgtgggagcgtcagtcccgccaggaaagca
gcttctgtgctggagccaagtccagttggagaaaagcgcaaacccacggagcctctccac
cacgaggagaacaagagacccagggtgttgggtgacatccccatggacctcatcaacgaa
gtcatggcaaccatcgcggatcccgctgccattccagagaccagtctgctgtcggctcac
tctgcgcgtgacgaagccgcccgtctggaggagcgcaggggcgtgatcgaattccatgtc
atcggtaactccctgaaccagaagcccaataagaggatcttgatgtggctcgtcggcctc
cagaacgtcttctctcaccagctgccccgcatgcccaaggagtacatcacacgactggtc
tttgacccgaagcacaagacgctgtcgctgatcaaggacggacgggtgatcggggggatc
tgcttccgcatgttcccgtcccaagggttcaccgagatcgtcttttgcgccgtgacgtcc
aacgagcaagtgaagggctacgggacccacttgatgaaccacctgaaagagtatcacata
aagcacgagatcctcaatttcctcacctacgctgacgagtacgccatcggctacttcaaa
aaacagggtttttcaaaggatatcaaggtacccaaggccaaatacgtgggctacatcaaa
gattatgagggggccacactgatgggctgtgagctcaaccccagtattccttatacagag
ttctctgtcatcatcaagaagcagaaggagatcatcaagaagctgatagagaggaagcag
gctcagatccggaaagtttacccggggctctcgtgctttaaagaaggcgttcggcagatc
cccatcgaaagcattcccggcatccgtgaaactggctggaagcctgtcggcaaagggaag
gaactgaaggatccagatcagctgtacagcactctgaagaccatccttcagcatgtaaag
atgcaccagaatgcctggcctttcatggagccggtcaagaaaacagaggcccctgggtac
taccagtccattcgcttccccatggacctcaaaacgatgagcgagcgtttgaaaagcagg
tactacaccacgcgcaagttgttcatggccgacatgcagcgcatcttcactaactgccgt
gaatacaacccccccgagagcgagtactacaagtgcgccaacctactggagaagttcttc
tacaccaagattaaagaggcaggcctgattgagaagtaa

DBGET integrated database retrieval system