KEGG   Takifugu rubripes (torafugu): 101070932Help
Entry
101070932         CDS       T02386                                 

Gene name
usp1
Definition
(RefSeq) ubiquitin specific peptidase 1
  KO
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    101070932 (usp1)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101070932 (usp1)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101070932 (usp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 806 aa AA seqDB search
MPGLQGENVVAALGSPVRRNKLSLKFLQRKETKRALDFSESQADEPKAFDSLEPEPSPCD
QVVPGPSPCPASPGFLLPSEKRETLVPFVGLNNLGNTCYLNSVLQVLYYCPGLRDGVKKL
HKLSKRKAKSQKEEEKNEQTAEVTEDLPPQVELLASFNSLIISIEQLQSGFLLNPDSFGD
ELATPPRKILHTLRQLNPMYEGYLQHDAQEVLQCILGYIQEACDTIRKEQGLNRDEAATE
VKHEDENTVAEPKSSTEDENQVGSKRKSDTEVGNAKKKPKSVDAKKSEAEEEVRNKPVTR
SKRRSSSDVMVSTREAEDAGTKKLHKEEEAESDGEAKGDKTSKRKKKTKLSWLRPSGKQP
SIFSKFRRLGKISCTTVKLPNKPEQENGLGEGQRSSEEASEERPPQNMAALKSAGRCQDG
LDLMETLFQGQLVLRTRCLECESFTERREDFQDISVPVLDDSPSSPGDFSSVSPDPKPEL
KTLTWAIGQFASAERIVGEDKYFCETCRHYTEAERSLLFDKTPEVITIHLKRFSANSLEL
DPYAGLSKVNTPLQTPLSLSLEEWCTQPSAAQGQHYRLFAVIMHSGVTIGSGHYTAYVRM
SDLSDVKLRPADGPESEEEEEESKPAPAKKDELPSYDDGEVSFNLNRRGLSLAGGKTGGK
KLSEGGVGLLGGQRSLSSYQLGTSNAHPEKAASAEGPKRRKTISLSQNPEAGLKKEPGVG
EEAPASSCGPAGATEQRALDHLLQYEGKWLLFDDCEVRLFQEEDFLRACSPETCSSSTPY
LLFYRRVAEPAPSRAAAGAAAQGRKY
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcctgcaaggtgaaaatgtggtggcggctttggggagccccgttagacggaat
aaactctctctcaagttcctccagaggaaagaaaccaaacgggctctagatttctccgaa
tcccaagcagatgagccgaaagcgtttgactcactggagcccgagcccagcccctgtgac
caggtggtcccgggcccgtctccatgtccagcctcgcctggctttctgctgccatcagaa
aagagggagaccctggttccattcgtgggcctcaacaacctcggcaacacctgctacttg
aacagtgtcttacaggtgctctactactgcccagggctcagagacggcgtgaagaaactg
cataaactgtccaaaaggaaagcaaagtctcagaaagaagaggagaaaaatgaacagacg
gcagaggtcacggaggatttgccaccgcaggtggagctcctggcgagcttcaacagcttg
attatctccatcgagcagctccagtctggtttcctgctgaaccccgacagcttcggggac
gaactcgccactcctcctcggaagatcctccacacgctcagacaactaaaccccatgtat
gaaggttatctccagcacgatgcccaggaggtgctgcagtgcatcctgggatacatccaa
gaggcttgtgataccatcaggaaagagcaggggttgaacagggacgaggcagcaactgag
gtgaaacatgaggatgaaaacacagtagcagaacccaagagttccacagaagatgagaac
caagtgggcagcaagagaaagagcgacacagaggtgggaaacgccaaaaagaagccaaaa
tctgtggacgcgaagaaatctgaggcagaggaagaagtaaggaacaagcctgtcactcgg
tccaaaagacggtcgtccagcgacgtgatggtgagcacacgagaggcggaggatgctggg
acgaagaagctccataaggaggaagaagcggagagtgacggcgaggcaaaaggcgacaaa
acctccaaacgaaagaagaaaaccaaactgagctggctgaggccttctgggaaacaaccc
agcatcttctccaagttccgccgcctggggaagatcagctgcaccactgtgaagctccca
aacaaaccagagcaggaaaacgggctgggcgagggtcagaggtcaagtgaggaggccagt
gaagagagacctcctcagaacatggccgcactcaagagcgccggcagatgtcaggacggc
ctggatctgatggagaccttgttccagggtcagctggttctcaggactcgctgcctggag
tgtgagagcttcacagagaggagagaagactttcaggacatcagcgtcccggtgctggac
gactcgcccagcagcccgggggacttctcttcagtgtccccggatccaaagccagagctg
aagaccctgacctgggccatcgggcagtttgcctccgcggagcgcatcgtcggggaggac
aaatacttctgcgagacctgccgtcattacacagaagcggagaggagtctcctgtttgac
aaaactcctgaagtcatcaccatccacctcaaacgcttctccgccaacagcttagagttg
gacccctacgctgggctgtccaaggtgaacacccccttgcagaccccgctgagcctgtcc
ctggaggagtggtgcacgcagccctcggccgcacaggggcagcactaccgcctctttgcc
gtcatcatgcacagcggcgtcaccatcggcagcggccactacaccgcctacgtccgcatg
agcgacctgagcgacgtcaagctgaggccagcggacggcccggagtccgaggaggaggag
gaggagagcaagcccgcgcccgccaagaaagacgagctcccgagctacgacgacggagag
gtgtcgtttaacctgaacaggagaggcttgagtttggccggtgggaaaacgggaggcaag
aagctgtccgaggggggggtgggactcctgggaggccagaggagtttgtccagttatcaa
ctgggaaccagcaacgcgcacccggagaaagcggccagcgccgagggccccaaacggagg
aaaaccatcagcctgagccaaaaccctgaagcgggactgaagaaagagcccggggtggga
gaggaggcccccgccagcagctgtggcccagcgggggccacggagcagcgggcgctggac
cacctcctccagtacgaaggcaagtggctgctgttcgacgactgcgaggtgcgcctgttc
caggaggaggacttcctgagagcctgctcccccgagacctgctcctcgtccacgccgtac
ctgctgttctacagacgcgtggctgagccggcgcccagcagagctgccgccggggccgcc
gcacagggccggaaatactga

DBGET integrated database retrieval system