KEGG   Takifugu rubripes (torafugu): 101070932Help
Entry
101070932         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 1-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    101070932
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101070932
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101070932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 800 aa AA seqDB search
MPGLQGENVVAALGSPVRRNKLSLKFLQRKETKRALDFSESQADEPKAFDSLEPEPSPCD
QVVPGPSPCPASPGFLLPSEKRETLVPFVGLNNLGNTCYLNSVLQVLYYCPGLRDGVKKL
HKLSKRKAKSQKEEEKNEQDLPPQVELLASFNSLIISIEQLQSGFLLNPDSFGDELATPP
RKILHTLRQLNPMYEGYLQHDAQEVLQCILGYIQEACDTIRKEQGLNRDEAATEVKHEDE
NTVAEPKSSTEDENQVGSKRKSDTEVGNAKKKPKSVDAKKSEAEEEVRNKPVTRSKRRSS
SDVMVSTREAEDAGTKKLHKEEEAESDGEAKGDKTSKRKKKTKLSWLRPSGKQPSIFSKF
RRLGKISCTTVKLPNKPEQENGLGEGQRSSEEASEERPPQNMAALKSAGRCQDGLDLMET
LFQGQLVLRTRCLECESFTERREDFQDISVPVLDDSPSSPGDFSSVSPDPKPELKTLTWA
IGQFASAERIVGEDKYFCETCRHYTEAERSLLFDKTPEVITIHLKRFSANSLELDPYAGL
SKVNTPLQTPLSLSLEEWCTQPSAAQGQHYRLFAVIMHSGVTIGSGHYTAYVRMSDLSDV
KLRPADGPESEEEEEESKPAPAKKDELPSYDDGEVSFNLNRRGLSLAGGKTGGKKLSEGG
VGLLGGQRSLSSYQLGTSNAHPEKAASAEGPKRRKTISLSQNPEAGLKKEPGVGEEAPAS
SCGPAGATEQRALDHLLQYEGKWLLFDDCEVRLFQEEDFLRACSPETCSSSTPYLLFYRR
VAEPAPSRAAAGAAAQGRKY
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcctgcaaggtgaaaatgtggtggcggctttggggagccccgttagacggaat
aaactctctctcaagttcctccagaggaaagaaaccaaacgggctctagatttctccgaa
tcccaagcagatgagccgaaagcgtttgactcactggagcccgagcccagcccctgtgac
caggtggtcccgggcccgtctccatgtccagcctcgcctggctttctgctgccatcagaa
aagagggagaccctggttccattcgtgggcctcaacaacctcggcaacacctgctacttg
aacagtgtcttacaggtgctctactactgcccagggctcagagacggcgtgaagaaactg
cataaactgtccaaaaggaaagcaaagtctcagaaagaagaggagaaaaatgaacaggat
ttgccaccgcaggtggagctcctggcgagcttcaacagcttgattatctccatcgagcag
ctccagtctggtttcctgctgaaccccgacagcttcggggacgaactcgccactcctcct
cggaagatcctccacacgctcagacaactaaaccccatgtatgaaggttatctccagcac
gatgcccaggaggtgctgcagtgcatcctgggatacatccaagaggcttgtgataccatc
aggaaagagcaggggttgaacagggacgaggcagcaactgaggtgaaacatgaggatgaa
aacacagtagcagaacccaagagttccacagaagatgagaaccaagtgggcagcaagaga
aagagcgacacagaggtgggaaacgccaaaaagaagccaaaatctgtggacgcgaagaaa
tctgaggcagaggaagaagtaaggaacaagcctgtcactcggtccaaaagacggtcgtcc
agcgacgtgatggtgagcacacgagaggcggaggatgctgggacgaagaagctccataag
gaggaagaagcggagagtgacggcgaggcaaaaggcgacaaaacctccaaacgaaagaag
aaaaccaaactgagctggctgaggccttctgggaaacaacccagcatcttctccaagttc
cgccgcctggggaagatcagctgcaccactgtgaagctcccaaacaaaccagagcaggaa
aacgggctgggcgagggtcagaggtcaagtgaggaggccagtgaagagagacctcctcag
aacatggccgcactcaagagcgccggcagatgtcaggacggcctggatctgatggagacc
ttgttccagggtcagctggttctcaggactcgctgcctggagtgtgagagcttcacagag
aggagagaagactttcaggacatcagcgtcccggtgctggacgactcgcccagcagcccg
ggggacttctcttcagtgtccccggatccaaagccagagctgaagaccctgacctgggcc
atcgggcagtttgcctccgcggagcgcatcgtcggggaggacaaatacttctgcgagacc
tgccgtcattacacagaagcggagaggagtctcctgtttgacaaaactcctgaagtcatc
accatccacctcaaacgcttctccgccaacagcttagagttggacccctacgctgggctg
tccaaggtgaacacccccttgcagaccccgctgagcctgtccctggaggagtggtgcacg
cagccctcggccgcacaggggcagcactaccgcctctttgccgtcatcatgcacagcggc
gtcaccatcggcagcggccactacaccgcctacgtccgcatgagcgacctgagcgacgtc
aagctgaggccagcggacggcccggagtccgaggaggaggaggaggagagcaagcccgcg
cccgccaagaaagacgagctcccgagctacgacgacggagaggtgtcgtttaacctgaac
aggagaggcttgagtttggccggtgggaaaacgggaggcaagaagctgtccgaggggggg
gtgggactcctgggaggccagaggagtttgtccagttatcaactgggaaccagcaacgcg
cacccggagaaagcggccagcgccgagggccccaaacggaggaaaaccatcagcctgagc
caaaaccctgaagcgggactgaagaaagagcccggggtgggagaggaggcccccgccagc
agctgtggcccagcgggggccacggagcagcgggcgctggaccacctcctccagtacgaa
ggcaagtggctgctgttcgacgactgcgaggtgcgcctgttccaggaggaggacttcctg
agagcctgctcccccgagacctgctcctcgtccacgccgtacctgctgttctacagacgc
gtggctgagccggcgcccagcagagctgccgccggggccgccgcacagggccggaaatac
tga

DBGET integrated database retrieval system