KEGG   Takifugu rubripes (torafugu): 101070972Help
Entry
101070972         CDS       T02386                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 45-like
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101070972
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101070972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 584 aa AA seqDB search
MLIDLIQEVKEKGYKLRICPPVETNLSPLTVTLPSPEPLTAAMFLFLLNMKEPGKDPLNP
KLLFNQLCQKAPRFKGYQQQDSQELLHYLMDSIRVEETKRVKVGILKAFNNPTEKTADED
IKRQVKAYGKEGVRMNFIERIFVGELTNTIMCEECGHISTVKEAFIDISLPIIEERISKP
SNPSRLGKGSREQDTHASHGEVFSAAHSSNRNNKKLSGQKQQVVRSLSSAEERGAACSAD
RPEEEGTASGSARGVSAGNLSDGSERDSGAQDSSNDADSEASESECAPQTSSLSHGHAST
TSSTSTLTPSPTPASTSSPVSASCVRRGGSVEQLVSAVSKVNLSFSAGDGSTHYSLEEQG
EAQTRENLHHQHHQGAFQALSHSYIPSSKECSIQSCLHQFTSVELLMGNNKLLCENCTER
RQKHLHKSASADKKGEKMYTSARKQMLISSLPPVIILHLKRFHQAGMNFRKVNRHVDFPL
ILDMAPFCSALCKNLAAGERVLYSLYGIVEHSGSMRVGHYTAYVKVRPPQRKTEQHHKNL
SGAKDGGSVSQGQWVYISDTTVQMVPESRVLNSQAYLLFYEELL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgctcattgaccttatccaggaagtcaaggagaaagggtacaaactaaggatctgcccc
cctgtcgagaccaacctgagcccactaacggtaacactacccagtccggagcccctgact
gcagccatgtttctcttcctgctgaacatgaaagaaccagggaaagatccactcaatccc
aaactcctcttcaaccagctctgtcagaaggctccacgcttcaagggctaccaacaacaa
gacagccaggagcttctgcactacctgatggactcgatacgagtggaggaaacaaaaagg
gtgaaagtgggaattctgaaggcttttaataatcctactgagaagacagcagatgaggac
atcaaacgccaagtgaaagcatatgggaaggaaggtgtacgtatgaatttcatcgagcgc
atctttgttggcgagctgaccaacactattatgtgtgaggagtgtgggcatatttccact
gtaaaagaggctttcattgacatctctttacccatcatagaggaaaggatatcaaaacca
tccaaccccagtaggctggggaagggcagtcgggagcaggacacacacgcgagtcacgga
gaggtgttttctgcagcacattcttccaacaggaacaacaagaagctgagtggacagaag
cagcaggtcgtgaggtctttgagctctgctgaagagaggggagcagcctgcagcgcagac
aggccagaggaagaggggacagccagtggatcggcccgaggtgtgtcagctggcaacctc
tcagatggcagtgagagagattcaggtgctcaggacagtagcaacgatgctgacagtgag
gcttcggaaagcgagtgtgccccccagacttcgtccctcagccacgggcatgcgtccaca
acatcgtccacttccaccctgactccgtctcctacaccagcatccacttcctcccctgtc
tcagcgtcctgtgtgaggcgaggtggcagtgtagagcagctggtatcagccgtgtcaaag
gtcaacctcagcttctctgctggagatggctctacacactattcactagaggagcaggga
gaagcacagaccagggagaacctgcaccatcaacaccaccagggggccttccaggcactg
tcccacagctacatacccagctccaaggagtgctcgatccagtcctgtctgcaccagttt
acctctgtggagctgctgatgggcaacaacaagctgctgtgtgagaactgtactgagcgc
agacagaaacacctgcacaagagcgcctcagctgacaaaaagggtgaaaaaatgtacacc
agtgccaggaagcagatgctgatatcctcactgcccccagtcatcattttacatctgaaa
cgcttccatcaggcggggatgaacttccgcaaagtgaatcgccatgttgactttcccctg
atcctggatatggccccattctgttcagcattgtgcaagaacctggcagccggcgagcgt
gtcctctacagcctgtatgggattgtggaacacagcggctccatgcgagtggggcactac
actgcatacgtcaaagtccgccctcctcagaggaaaacagaacagcaccacaagaacctg
tcaggtgcgaaggatggtggcagcgtctcccagggtcagtgggtttacatcagtgatacg
accgttcagatggtaccggagtcacgggtactcaactctcaggcgtacctgcttttttat
gaggaattactgtaa

DBGET integrated database retrieval system