KEGG   Takifugu rubripes (torafugu): 101071001Help
Entry
101071001         CDS       T02386                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101071001
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101071001
Glycosyltransferases [BR:tru01003]
 Glycan extension
  Type 3 chain
   101071001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 392 aa AA seqDB search
MKILGPKISFYVGFMVGTVTLYVFLRQVRIEKSFFTQRASSLDKLSQQLEEDEKVWKKDR
SALFNLKHPHHTGEDGHVADELYKKVRILCWVMTGPNNLEIKARHVKNTWTRHCNIVVFM
SSVDDPNFPTVGLGTKEGRDQLYWKTIRAFHYAYEHHIDEADWFLKADDDTYVIVDNLRW
LLANHTPDEPIYYGRRFKPYTKQGYMSGGAGYVLSKEALRRFVEGFRTKVCSHTSSVEDL
AMGQCMEKVGVLAGDARDGLQRETFHPFVPEQHLTAKFPKSFWYWSYCYYPISEGPNCCS
DLSVSFHYVDSTLMYILEYYVYHLRAFGYQYRFHPPIPPVVSTERLAPSGPVQPDEELAS
REEGPDEEADLSRTKIQAEEFPAAASKELPSQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgggccccaaaatctctttttatgtggggttcatggtgggaaccgtcacg
ctgtacgtgtttctgcggcaagtgcgcattgagaaaagtttctttacgcaacgggcgtct
tccctcgacaaactgtcgcagcaactggaggaagacgagaaggtttggaagaaggacaga
tctgctctcttcaacctgaagcaccctcatcacacaggtgaagatggccacgtggccgac
gagctgtacaaaaaggtgcgtattctttgctgggtgatgacaggccccaacaacctggag
atcaaggcacggcacgtcaaaaacacgtggacgcgccactgtaatatagtggtgttcatg
agctccgtggacgaccccaacttccccacggtgggcttaggtacgaaagagggtcgggac
cagctttactggaaaaccatccgggccttccactacgcctacgagcatcatatcgacgag
gctgactggttcctcaaagcagatgacgacacgtacgtcatcgtggacaacctccggtgg
cttcttgcgaaccacacgcccgatgagccgatctattacggccggagattcaaaccctac
accaagcagggctacatgagcggcggcgcgggctacgttttgagcaaagaggctctccgg
cgcttcgtggaaggattcagaaccaaggtgtgctctcacacctcctcggtagaggacctt
gccatggggcagtgcatggagaaagtgggcgtgctggcaggggacgccagagacggtttg
caaagggagacgtttcacccgtttgttcccgagcagcacctgacagcaaagttcccaaag
agcttctggtactggagctactgttactaccccatctcagagggccccaactgctgctcc
gacttgtcggtctccttccactatgtggactctactctcatgtacatactggagtattac
gtctatcacctgcgtgcctttggttaccaataccgcttccacccccccattccccctgtc
gtttctactgagcggttggccccctcaggtcctgtgcaaccagatgaagagctggcttct
cgggaggaagggccggatgaggaggctgatctgtccaggactaagatccaggctgaagag
tttcccgctgcagcaagtaaagagcttccaagccagtaa

DBGET integrated database retrieval system