KEGG   Takifugu rubripes (torafugu): 101071089Help
Entry
101071089         CDS       T02386                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101071089
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     101071089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 774 aa AA seqDB search
MAASIPPDKAQSLPNNILIKEDPEAEECVNGSTEDCTIKRDPVVPLLSPVSGLQPLVWSE
DHRLAVCTSGSLSVMELVCDVNNSNLDLTLHRTSIAVPTEAHRFQGGPAAEFAEAVEKFS
THPDPYIRQVFLADTVMNPALGGHKGIKHAAWSPLGCDLNGCCLLACLTLDNRLTIHNSH
KRLEWNTLVNLSKKYSNRLKEQGYAGKDNKPPVANLLDFDELQRRFRMQTPLRMEWSSIY
TVKHFQPNNTCIDIEMVLLAVLMENGDLVLWKFVLPFLNGDGVEFFDLMESGVTSPSDLA
WWEYENGERRMSGLIVGSEVGPVKIMPVSLPGVKGYFTLRHPIILWKECDEIAVGNLKCI
SMVHPIQKTSCSLIVASRGCYVFWCLLMISPAGLNVHNSHVAGLHSLPVLSLAVSRHGIA
VYTCSIDGWIKKLTPTFTENSLIFKQEDVVRPESITARRIHSIAVSYNGAYIALVSTQGM
VCGYHPINRTYQVHFMTLKTPEMASALLLESPIQNLYRMTDLLDLVRWQILKDKCIPASL
MDELEQKIRETDSTYLWRFKLFLVRILCQSLQSPLTEHRWKPSQEGSQVVDSQDQEDTKD
MEGSSYEEERSEVKQEATYEEKLAQTQALIGSIEKHLMRENMKKVLGAVYLNTCITQNTS
IPTCGLMEYLSGDANDRDLEVLIGHIKKKMAKQTFSEHCSLCREVLPFSDHKQTVCENAH
LWLRCVLSHQACQSLTFRRCLLQDSIAKLPEPEEPEWIKKLLQAPCTLCDSPMI
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccattccgcctgacaaggcgcaatcgctacccaacaatatactcataaag
gaagatccagaagctgaggaatgcgtcaacggcagtacagaagattgcactatcaagcgg
gaccccgttgtccctctcttgtcccctgtcagcggactacaaccgctcgtgtggtcggag
gaccaccgcctggctgtgtgcaccagcggctccttatcggtgatggagctggtatgcgat
gtcaacaacagcaacctggatctgacgctgcatcggacatcgatagctgtcccgaccgaa
gcgcatcgatttcaggggggaccggcagcagagtttgctgaagcagtggagaagttctct
acgcatccagacccctacataaggcaagtttttctggctgacacggtgatgaatccagca
ctcggagggcacaaaggaattaaacacgctgcctggtctccgctgggctgcgacttaaat
ggatgctgcctcctcgcctgcctaacacttgacaacagactcacgattcacaacagtcac
aagcgtctcgaatggaacacgttggtaaacctctcaaagaaatacagcaacaggctaaaa
gaacaaggatatgcagggaaggacaacaagcctccagtggcaaacctcctggactttgat
gagctgcagcggcgtttccgcatgcagacgccactgaggatggagtggtcgagcatttac
acagtcaagcattttcagcccaacaacacctgcatagacattgaaatggtccttcttgct
gttctaatggagaatggagaccttgttttgtggaagtttgtcttgcccttcttaaatggt
gacggcgtcgagttctttgacctcatggagtcaggcgtgaccagccctagcgatttggcg
tggtgggaatatgaaaacggagaacgccggatgagtggattgatagttggcagtgaggtg
ggaccggtcaaaatcatgccggtcagccttccaggcgtgaaggggtacttcaccctgcga
caccccatcatcctctggaaggaatgcgacgaaatcgccgtcggaaacctgaaatgcatc
tctatggttcacccgatccaaaaaacaagctgcagcctcattgtggcgtcgcgcggctgc
tacgtcttctggtgtctgctcatgatttcgccggctggtcttaacgtgcacaactctcac
gtggccggactgcactcgcttcccgtgctctcgttagcggtcagccggcacggcatcgct
gtgtacacgtgctccatagacgggtggatcaaaaaactgacacccacgttcacagagaac
agtttgattttcaagcaggaggacgtggtgcgacccgaaagcataacggcaaggcggatt
cacagcattgcagtaagttacaatggtgcatatattgctcttgtcagcactcaaggtatg
gtttgtggttatcatcccattaataggacgtaccaggttcactttatgaccctaaaaaca
ccagaaatggcatcagcgctgctactcgagtctcccatccaaaacttatacagaatgaca
gacttgcttgatcttgtcaggtggcagatcttgaaagacaagtgcatccctgcgtcactg
atggacgaacttgagcagaagatcagggaaacggactcaacctatttgtggcgtttcaaa
ctgtttttggtccggatactgtgccagtccctacagtcccccctcaccgaacaccgctgg
aaaccctcacaggaaggcagccaagttgttgatagccaagaccaggaagacacaaaggac
atggaaggcagctcatatgaggaagagcggtccgaagtgaaacaagaggctacttatgag
gagaagctagcacagacgcaagctctgattggctccattgagaagcacctgatgagggaa
aacatgaagaaggtgctgggggcggtctacctcaacacctgcatcactcagaacaccagc
attcccacctgtggcctgatggagtacctctctggagacgctaatgacagagatttagag
gtcctgattggtcacatcaagaagaaaatggccaagcagaccttctcggagcactgcagc
ctgtgtcgggaggtgttgcctttctcagatcacaagcagacagtgtgtgaaaatgctcac
ttgtggctcaggtgtgtgttgtcacaccaagcctgccagtcactgacgtttagacgatgc
ctcctgcaggattccatcgccaaactgccagagcctgaggaacccgagtggatcaagaag
ttactgcaggcgccctgcacgctctgtgactcaccgatgatctag

DBGET integrated database retrieval system