KEGG   Takifugu rubripes (torafugu): 101071135Help
Entry
101071135         CDS       T02386                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101071135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 455 aa AA seqDB search
MAEVKACVFYGIVASFLTSAVFAFVEDLDDTFKDKRVNDIWLVDFYAPWCGYCKKLEPIW
NEVGLELKISGSPVRVGKMDATAYSGMSSEFGVRGYPTIKLLKGDLAYNYKGPRTKDDII
EFANRVAGPAVRSLPSKEMFEHMLKRHNVLFVYVGGESPLKEKYNDVASELIVYTHFFSA
LEQVFPESLTLPELPAVVVFKDGGYFTYDEYEDASLSSWVNRERFQGYLQIDGFTLYELG
ETGKLVAIAVIDEKDPTEESDRLKTLMQRVAKEHREHFSRDFQFGHMDGNDYINSLIMGE
VAVPSVIILNTSNEQYFLPSEAVGTMEQLVHFIKSVLNGSAQAYGGDGFIQRIKRIAFDA
KSTITSVFRSSPLLGCFLFGLPLGVISLMCYGICTAESDYGSDDTDALKRLTDEEDEDEE
EEQEREQSAELEGPEEDELEGEEGAEKDPAEKKTD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtgaaagcttgtgtgttttatggaattgtggcgtctttcctgacttcagcc
gtgtttgccttcgttgaagacctggacgacacatttaaagacaaaagagtcaacgacatc
tggctggttgatttctacgccccgtggtgtggctactgcaaaaaactagagcccatatgg
aacgaggtgggacttgagctgaagatctccgggtccccggtccgcgtggggaagatggac
gccacagcgtactctggaatgtcgtcggagttcggcgttcgtggttacccaaccatcaaa
ctgctaaagggggatcttgcctataattacaaaggaccgaggacaaaagatgatattatc
gagtttgccaacagggtagcgggaccggccgtccgatctcttccgagcaaggagatgttt
gagcacatgctgaaacggcacaatgtgctctttgtgtacgtcggcggggagtctcctctc
aaagagaagtacaatgacgtggcttccgagctcatcgtttacactcacttcttctcggcc
ttggagcaggtttttccagagtctctaactttaccggagcttcccgcagtggtcgttttt
aaagatggaggctacttcacctacgacgagtatgaagacgctagcctgtcgtcctgggtg
aacagggagcgcttccaaggatatctccagatagacgggttcaccctgtacgaactcgga
gaaactggcaaattggtggcgattgctgtcatcgatgagaaggaccccacagaggagagc
gacagactaaagactctgatgcagagggtagcgaaggaacacagggaacattttagcaga
gacttccagtttggacacatggacgggaacgactacatcaacagtctcattatgggtgaa
gtggcggtgccctccgtcatcatcctcaacacctccaacgagcagtacttcctgcccagc
gaggccgtcggcaccatggagcagctggtccacttcatcaagagcgtcctgaacggttct
gcacaggcgtacggaggagacggcttcattcagaggatcaaacgcatcgcctttgatgcc
aaatccaccatcacgtccgtgtttcgcagctctcctctgctgggctgcttcctcttcggc
cttccgctgggcgtaatcagcctgatgtgctacggcatctgcacggccgagtccgactac
gggtcggacgacactgacgcgctcaagaggctgaccgacgaggaggacgaggacgaggag
gaggagcaggagagggaacagtccgccgagctggaggggcccgaagaggatgagctggaa
ggagaggagggagcggaaaaggatccggcggagaagaaaacggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system