KEGG   Takifugu rubripes (torafugu): 101071229Help
Entry
101071229         CDS       T02386                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101071229 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101071229 (pik3cg)
   04370 VEGF signaling pathway
    101071229 (pik3cg)
   04630 Jak-STAT signaling pathway
    101071229 (pik3cg)
   04068 FoxO signaling pathway
    101071229 (pik3cg)
   04070 Phosphatidylinositol signaling system
    101071229 (pik3cg)
   04150 mTOR signaling pathway
    101071229 (pik3cg)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101071229 (pik3cg)
  Cell growth and death
   04210 Apoptosis
    101071229 (pik3cg)
  Cellular commiunity
   04510 Focal adhesion
    101071229 (pik3cg)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101071229 (pik3cg)
  Endocrine system
   04910 Insulin signaling pathway
    101071229 (pik3cg)
   04914 Progesterone-mediated oocyte maturation
    101071229 (pik3cg)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101071229 (pik3cg)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101071229 (pik3cg)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101071229 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 1038 aa AA seqDB search
MDGEQAQLSDEDSAIVTGDHSRRRRRRRKAVGSAPHSSMDQISVEFVLPAAARCKSGSDK
LLLDVAANWTVEQVKTQVWLRAVTLNICPDFYQRFSPDQCILLYQKKGSVCEIYDKHQVF
QTLDCVCYWRALKKEVGRIQLVLRPQPSEESLQYQRYLNYLMGYDVTDVSNVHDDELEFT
RRKLLTPRRLELMERDPKLYSMDPWVTCKNLPEHLLSKVSNGSILVVIHVSTVSQTIKVS
IGDSPAQVLTSFFAKTSNKRVLLGIPENLSETDFVLRVCGREEYLYGDKPLQNFNWVRQC
LKNGEEIHLVLETPPNPDLDLVQKEDWAQVDDCTGVAGTHEQLTIDGKDHERVFTISMWD
CNRKFRVKVLGIDIPSLPKIPDFLVFVEASIFHGQQLLAQERTSSKTFTEEVLWNCWLEF
NIKIKDLPKGARLSLQVVCRKQPQTLNSKGGSAQQDSPAAAAAGGHDGKTKSRLLYYVNL
LLVDHRSLLRQGEFILHMWKMPEKSDESSSSINADKLTSATNPDRASSMAVAILLDKYCY
PVVLPKSRAASREARGGVEEAQGGERGQREMPNHLRKQFAVIVRTDPLHPLSPEDKELLW
HFRHECTRDPRAYPKLLSSVSWGKQEDVLETHRLLERSSAWDSSGLDVGLAMQLLDCHFS
DAQVRSLAVRKLETLEDDDVLRYLLQLVQAVKFEPYHDSSLVRFLLKRALRSKRIGHFLF
WFLRSEIAQSMHYQQRYAVLLEAYLRGCGEDMLQDFRKQVETTEALQKVTREIKTVSADK
YDITAQVVFQLRQKLEALQSSGLPEDFRVPYDPGLRAGALLIEQCKVMASKKKPLWLQFK
RADSTTLSKDPIGIIFKDGDDLRQDMLILQILLIMESIWETESLDLCLLPYGCISTGNRI
GMIEIVKDATTIANIQQSVVGSTGAFKDEILCQWLRDKCVNEDKFQQAVERFLHSCGGYC
VATYVLGIGDRHNDNIMITESGNLFHIDFGHILGNYKSFMGISKEWVPFVLTPDFLYVMG
TSGKKSSPNFQKFQVPQT
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atggatggggagcaggcgcagctgagtgacgaggattccgcaatcgtaacaggagaccat
tcgaggaggaggaggaggaggaggaaggccgtcggctcggctccccacagctccatggat
cagatcagtgtggagttcgtcctgccggctgcagccagatgcaaaagtggttctgacaag
ttgctcctggacgtggcggcgaactggaccgtggaacaggtgaagactcaggtgtggctg
agggccgtgaccctgaacatctgccctgacttctaccagcgcttctctccggaccagtgc
atcctgctctaccagaaaaaaggcagcgtgtgtgagatctacgacaagcaccaggtcttc
cagacgctggactgcgtctgctactggagagccctgaagaaagaagtggggcggatccag
ctggtgctccgcccccagccgtcggaggagtcgctgcagtaccagcgctacctcaactac
ctgatgggctacgacgtgacggacgtcagcaacgtgcacgatgacgagctggagttcacc
cgcaggaagctgctgacgccgcggcgcctagaactgatggagcgggacccgaagctctac
tccatggacccctgggtcacctgcaagaacctgcctgagcacctgctgagcaaggtcagc
aacggttccatcctggtggtgatccacgtcagcacagtgagccagaccatcaaagtctcc
atcggcgactctccagcgcaggttttgaccagtttctttgccaagacatcaaataaaaga
gttctgctcggtattccggaaaacctgagcgagacggactttgtgctgcgcgtgtgtgga
agggaggagtatctgtacggtgacaaacctctgcagaacttcaactgggtccgacagtgt
ctaaagaacggggaggaaattcatctggttctggaaacgccacccaatcctgacctggac
ctggtccagaaggaggactgggctcaggtggacgactgtaccggagttgcgggtacccac
gagcaactgaccatcgacgggaaggaccacgagcgggtgttcaccatctccatgtgggac
tgcaacaggaagttcagagtcaaagtgctgggtatcgacatcccgtccctgccgaaaatc
ccagacttcctggtgtttgttgaagcgagcatcttccacggccagcagctcttagctcag
gagagaacctcctccaaaacatttactgaagaggttctgtggaactgctggctggagttt
aacatcaagatcaaggatctgccgaaaggagcacgtctcagcctccaggtggtttgtagg
aagcagcctcagactctaaactccaaggggggctcagcgcagcaggacagcccagcggca
gcggcagcgggcggccacgatggaaagaccaagagccgcctcctgtactacgtcaacctg
ctgctggtggaccaccgctcgctcctgcgccagggcgagttcatcctccacatgtggaag
atgccggagaagagcgacgagagcagcagcagcatcaacgccgacaagctgacctcggcc
accaacccggaccgggcgtcctccatggccgtcgccatcctgctggacaagtactgctac
cctgtggtgctgcccaagagccgcgccgccagccgggaggccaggggcggcgtggaggag
gcgcagggcggcgagcgggggcagcgggagatgcccaaccacctgaggaagcagttcgct
gttattgtgaggaccgacccgcttcatcctctgagcccagaggacaaggagctgctgtgg
cacttcaggcacgagtgcacgcgcgaccccagggcctaccccaaactcctgagctccgtc
agctgggggaagcaggaggacgtgttggagacgcaccggctgctggagcgcagctcggcc
tgggacagcagcgggctggacgtgggtctggccatgcagctgctggactgtcatttctca
gacgcgcaggttcgctcgctggccgtcaggaagctggagaccctggaggacgacgacgtg
ctgcggtacctgctgcagctggtgcaggcggtgaagtttgagccctaccacgacagcagc
ctggtccggttcctgctgaagagagctttgaggagcaaacgcatcggccacttcctcttc
tggttcctgcgcagcgagatcgcccagtccatgcactaccagcagcgctacgcggtgctg
ctggaggcgtacctgcgggggtgtggcgaggacatgctgcaggacttcaggaaacaggtg
gagaccaccgaagctctgcagaaagtcacgcgggagatcaagactgtgtctgccgacaag
tacgacatcaccgcccaagtggtgttccagctccgccagaaactggaggccctgcagtcg
tccggcctgcccgaggatttcagggtcccgtatgatcctggactcagagctggagccctc
ttgatcgagcagtgcaaagtgatggcgtccaagaagaagccgctgtggctgcagttcaag
cgggccgacagcaccacgctgtccaaagaccccatcggcatcatcttcaaggacggcgac
gacctcaggcaggacatgctgatcctgcagatcctgctgatcatggagtccatctgggag
acggaatcactggacctctgcctcctgccctacggctgcatctccactgggaacagaata
ggcatgattgagatcgtgaaagatgccaccaccatcgccaacatccagcagagcgtggtt
gggagcaccggagcttttaaagacgagatcctctgtcagtggctccgggacaagtgtgtc
aacgaggacaagttccagcaggccgtggagaggttcctgcactcctgcggcggctactgc
gtggccacctacgtcctggggatcggagatcgccacaacgacaacatcatgatcaccgag
tctggaaacctcttccacatcgactttggccacatcctggggaattacaagagtttcatg
ggaatcagtaaggaatgggttcccttcgttctcacgcctgacttcctctacgtcatggga
acctctggaaagaaaagcagccccaacttccagaaattccaggtgcctcaaacgtga

DBGET integrated database retrieval system