KEGG   Takifugu rubripes (torafugu): 101071291Help
Entry
101071291         CDS       T02386                                 

Definition
DNA polymerase delta subunit 4-like
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tru00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tru00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tru03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tru03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tru03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tru03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tru03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 107 aa AA seqDB search
MTTKHGLITDSFKVVKKARRERKREKRPSPPRQLKKEAEVVHEEELQKLQQFDLDWRFGP
CTGISRLQRWERAKLHNLNPPDEIKELLLKTQSDPSYSHSLWGEYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaagcatgggctgataaccgattcatttaaggtggtgaaaaaagcgaggagg
gagaggaaaagggaaaagagaccaagtccaccacgtcagctaaagaaagaggctgaagtg
gtgcacgaggaggagctgcagaagcttcagcagtttgatctagactggagatttggcccc
tgcacgggtatcagcaggttgcagaggtgggagagagctaaacttcacaacctgaacccg
cctgatgagatcaaagagctgctcctgaaaacccagtctgaccccagctacagccacagt
ttatggggagaatatcctctgtga

DBGET integrated database retrieval system