KEGG   Takifugu rubripes (torafugu): 101071363Help
Entry
101071363         CDS       T02386                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tru00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 541 aa AA seqDB search
MAWTPATALSVSLLLLSGFAQSRVEEENPEFWRSQAQKSLQSVLDRKLNTNVSRNILFFL
GDGMGVTTYTAARILRGQLQNQSGEETVMTMDTFPSVGLAKTYSVDFQIPDSAATATAFL
CGVKTNLNTIGVSAAARNGICKTQKGNEVTSILKWAKDAGKSVGIVTTTRVQHATPAASY
AHSASRKWYSDADVPESAKKDGCTDISSQLLNNTDIDVIMGGGRKYMTPRGTKDPEYPWD
FLSRGRRKDGRDLTKEWQSMKAGKVARYVWNKADFDAVDPETTDYLRVTLFEPGDLRFEV
XRDPKVDPSIVEMTEKAVRILRKNPKGFFLLVEGGRIDQAHHDGRAYMALHETIAFDDAI
AKGLELTDEHETLTVVMADHSHPITFNGFPFRGQSILGKSPLWGTDFKPYTTLMYGNGPG
YKLANGSRPDLRDVDTKTKDYVQMSAAPTESTTHSGEDVAVLARGPMSHLFQGVHEQNYI
AHAMAYAACVGTDLRHCDAPTGVPVVQTTTADDRNAAGPSGGSAASLGSLLAVLLLLKML
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggaccccagcgaccgcactgtccgtctccctgctgcttctctccgggttcgct
cagtccagagtcgaggaggagaacccagagttctggaggtcccaggcccagaagtctctt
cagtcggtcctggacaggaagctcaacaccaacgtttccagaaacatcctgttcttcctc
ggagacgggatgggagtgaccacatacacggcggcccgtatcctcaggggccagctgcag
aaccagagcggggaggagacggtcatgaccatggacacgttccccagcgtggggctcgct
aagacctacagcgtggacttccaaatcccagacagcgccgccaccgccacggcgtttctg
tgcggggtgaagaccaacctgaacaccatcggcgtcagcgcggcggcccgcaacgggatc
tgcaagacccagaagggcaacgaggtcacgtccatcctgaagtgggccaaagacgcaggc
aagtctgtgggaatcgtgacgaccacgcgggtgcagcacgccaccccggccgccagctac
gcccacagcgccagcaggaagtggtacagcgacgccgacgtgccagagtcggccaagaag
gacggctgcaccgacatctcctcccagctcctcaacaacaccgacatcgacgtcattatg
ggcggtgggagaaaatacatgacccccaggggcaccaaggaccccgaatacccctgggat
ttcctgtccaggggccgaagaaaagacgggcgtgacctcaccaaagagtggcagagcatg
aaggctggaaaggtggcccgctacgtgtggaataaagcagacttcgatgccgttgaccct
gaaacgacggactacttaagggtaactctgttcgaaccaggagatctgcgcttcgaggtg
nacagggaccctaaagtggatccatccatcgtggagatgacagaaaaggccgtccgcatc
ctccggaagaaccccaaaggcttcttcctgctcgtggagggcgggcgtatcgaccaggcg
caccacgacggccgggcgtacatggcgctccacgagaccatcgccttcgacgacgccatc
gccaaaggcctggagctgaccgacgagcacgagaccctgactgtggtgatggccgaccac
tcgcaccccatcaccttcaacgggttccccttcagagggcagagcattctgggtaaatcc
cccctctggggcacagacttcaaaccttacaccaccctcatgtacggaaacgggcccggg
tacaagctggctaacggcagccgtccggacctcagagacgtcgacaccaaaaccaaagat
tatgtccagatgtcggctgctccgaccgagtccaccactcacagcggcgaggacgtggcg
gtgctggcacgtgggcccatgtcccacctctttcagggcgttcacgaacagaactacatc
gcccacgccatggcctacgccgcttgtgtgggcaccgacctgaggcactgcgacgccccg
accggggtccctgtggtccagaccaccaccgccgatgacaggaacgcggccgggccgagt
ggcggttcggcggcttcgctcggcagcctcctcgccgttcttctgctcctcaaaatgctg
cggtga

DBGET integrated database retrieval system