KEGG   Takifugu rubripes (torafugu): 101071384Help
Entry
101071384         CDS       T02386                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3-like
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101071384
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101071384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 101071384
NCBI-ProteinID: XP_003972793
UniProt: H2UEF2
Position
18
AA seq 299 aa AA seqDB search
MLSYIIGLIRGGFDGIINLIFRLFFSKRRPAITLQDPNIKYALRLLDKQIVSHDTRKFRF
ALPSPEHVLGLPIGQHIYLTARISGNLVVRPYTPVSSDDDKGFVDLVVKVYFKDVHPKFP
EGGKMSQYLESLKIGDFIDFRGPSGLLVYKGKGVFAIQEDKKSPAETKTAKHLGMIAGGT
GITPMLQIVTAIMKDPKDQTVCHLLFANQSEKDILLREELEEIQVRHPDRFKLWFTLDRA
PEGWEYSQGFISEDMVRDHLPPPGDDTLILMCGPPPMIQFACNPNLDKVGHAASRRFNF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctacatcatcggcctgatccgaggcggctttgacggcatcattaacctgatc
ttcagactgttcttctccaagaggagacctgccatcaccttacaggacccaaacatcaaa
tacgccctgcggctgttggacaagcagatcgtcagtcacgacaccagaaagttccgcttt
gctctcccgtcccctgaacacgtcctgggcctccccatcgggcaacacatctacttgacg
gccagaattagtgggaacttggtggtgcgtccgtacacgccggtgtccagcgacgacgac
aaaggcttcgtggatttggtggtgaaggtttatttcaaagatgttcacccaaaattcccc
gagggcgggaagatgagccagtacctggagagcctgaagattggcgatttcatcgacttc
agaggacccagcgggctcctggtgtataagggcaaaggtgtttttgccattcaggaggat
aagaagtctccagctgagacgaagacggccaaacacctgggcatgatcgcaggagggaca
ggaatcactcccatgctgcagatcgtcacagccatcatgaaggatcctaaagatcagaca
gtttgtcacctcctctttgccaaccagtctgagaaagacatcctgctgagggaagaactg
gaggaaatccaggtgcggcacccagaccgcttcaagctgtggttcactctggacagagcg
cccgaagggtgggagtacagtcagggcttcatcagcgaggacatggtcagagaccacctg
ccaccccctggcgacgacaccctcatcctcatgtgtggacccccacccatgatccagttt
gcctgcaaccccaacttggacaaagtgggccacgccgccagccgcaggttcaatttttaa

DBGET integrated database retrieval system