KEGG   Takifugu rubripes (torafugu): 101071384Help
Entry
101071384         CDS       T02386                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tru00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 299 aa AA seqDB search
MLSYIIGLIRGGFDGIINLIFRLFFSKRRPAITLQDPNIKYALRLLDKQIVSHDTRKFRF
ALPSPEHVLGLPIGQHIYLTARISGNLVVRPYTPVSSDDDKGFVDLVVKVYFKDVHPKFP
EGGKMSQYLESLKIGDFIDFRGPSGLLVYKGKGVFAIQEDKKSPAETKTAKHLGMIAGGT
GITPMLQIVTAIMKDPKDQTVCHLLFANQSEKDILLREELEEIQVRHPDRFKLWFTLDRA
PEGWEYSQGFISEDMVRDHLPPPGDDTLILMCGPPPMIQFACNPNLDKVGHAASRRFNF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctacatcatcggcctgatccgaggcggctttgacggcatcattaacctgatc
ttcagactgttcttctccaagaggagacctgccatcaccttacaggacccaaacatcaaa
tacgccctgcggctgttggacaagcagatcgtcagtcacgacaccagaaagttccgcttt
gctctcccgtcccctgaacacgtcctgggcctccccatcgggcaacacatctacttgacg
gccagaattagtgggaacttggtggtgcgtccgtacacgccggtgtccagcgacgacgac
aaaggcttcgtggatttggtggtgaaggtttatttcaaagatgttcacccaaaattcccc
gagggcgggaagatgagccagtacctggagagcctgaagattggcgatttcatcgacttc
agaggacccagcgggctcctggtgtataagggcaaaggtgtttttgccattcaggaggat
aagaagtctccagctgagacgaagacggccaaacacctgggcatgatcgcaggagggaca
ggaatcactcccatgctgcagatcgtcacagccatcatgaaggatcctaaagatcagaca
gtttgtcacctcctctttgccaaccagtctgagaaagacatcctgctgagggaagaactg
gaggaaatccaggtgcggcacccagaccgcttcaagctgtggttcactctggacagagcg
cccgaagggtgggagtacagtcagggcttcatcagcgaggacatggtcagagaccacctg
ccaccccctggcgacgacaccctcatcctcatgtgtggacccccacccatgatccagttt
gcctgcaaccccaacttggacaaagtgggccacgccgccagccgcaggttcaatttttaa

DBGET integrated database retrieval system