KEGG   Takifugu rubripes (torafugu): 101071387Help
Entry
101071387         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase BAP1-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 749 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQSPVYGFIFLFKWIEERRSRR
KVNTLVDETSVIDEEIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGTTLSRIKAFTK
GFSPESKGYAIGNAPELARAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRL
FELDGLKAYPIDHGPWGEEEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YESKLEILKKNRQIILEGLQKVGNCQMIRLTQTELVHEKKEKDSSSPDDSTPAIKKEAES
EPVPAQSTDQAPSVAESGAQSKEATSPSENIMGKPSVPKGGGPPQVTSPNPIVQRLPAFL
DNHNYAKSPMQEEEDIAAGVGRTRMSAPPQPPYSDDEDDYEDEEEEVTGSAVTSNRFRRK
ASLRSRTGRVGTGVESQIALTVLAEKLKKEAQRKDALNTPLSVRTEGRTGGICITSASQP
SPTPSNESTDTASEIGSAFNSPLRSPARSQAATRPSSPVASHLSRVLFGEDEMLRLDSRH
NRAVRELGLSVSTALLHLQEDGVIFAVPPSVELTADCSKQPCTHEKTKDKGKASLIPKEK
EGVNEGDEGPSVEVKEKESKEGAEVDSSKETSSSLETVDNKPAGDKYSPKELLALLKCVE
ADIANYEVSLKEEVEKRKKYKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRR
RQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggttggctggagcttgagagtgatccaggactgtttactttgctggtggaa
gactttggtgtcaaaggtgtacaagtagaagaaatatatgatcttcaaagcaaatgccaa
agtcctgtctatggcttcatcttcctattcaaatggattgaggaacgtcgatccagaaga
aaagttaatacgctggtggatgagacctctgtcattgatgaagaaattgtaaatgacatg
ttttttgctcatcagctaattccaaattcctgtgccactcacgctttgctgagcgtgctc
ttgaactgcagtggtgtagagctcggcaccacccttagccgcattaaagctttcactaaa
ggattcagtccagagagtaaaggttacgcaataggaaacgccccagagcttgccagagca
cataacagtcatgctagaccggagcccagacacctaccagagaaacagaatggaatcagt
gcagtgcggaccatggaagccttccattttgttagttatgtccccatcaaagaccgcctc
tttgaacttgatggacttaaggcttaccccatagaccatggcccttggggggaggaagaa
gaatggactgataaagcccggcgggttattatggagagaattggacttgccactgcaggt
gaaccgtaccatgacattcgcttcaacctgatggcagtggtgcctgaccgcaggattaag
tatgaatccaagctggaaattttaaagaagaatcggcagatcattctagagggtctacag
aaggttgggaactgtcagatgattcgactgactcagactgaacttgtccatgagaagaaa
gagaaagactcctcttcacccgatgatagcactccagccatcaaaaaagaggcagaatct
gaaccagttccagctcagagcactgaccaagctccttcagtggctgagtcaggggctcag
tctaaggaagccactagcccatcagaaaatatcatgggcaaaccatctgtccccaagggt
ggaggtcctccacaagtcaccagccccaaccccattgttcagcgtctgcctgccttctta
gacaatcacaactatgccaagtctcccatgcaggaagaagaggatattgctgctggagtt
ggtcgcactcgaatgtcagcacctccacaaccgccatactctgatgatgaggacgactat
gaagatgaagaggaggaagtgactggttctgccgtcacttccaacaggtttagacggaag
gcgagtctgcgctcacgaacaggacgggttgggacaggagtggagagccagattgctctt
actgtgttggctgaaaaattaaaaaaggaagcccagaggaaagatgctttgaacactcct
ctatctgtacgcacagaaggccgcacgggaggcatttgcatcacatctgcctctcagcct
tcacccacacccagcaatgaaagtactgacacggcctcggagattggcagcgcctttaat
tctccgctacgctcacccgcgcgctcccaggctgccacacgcccatccagtccagttgcc
tcccatctgtcccgtgttctgtttggagaagatgagatgcttcgactggactctagacac
aaccgggctgtgagagaactgggtctgtctgtcagcacagccttgttgcacctgcaggag
gacggagtcatctttgctgtccctccatctgtggaactgactgccgattgttcaaagcag
ccctgtactcacgagaagacaaaagataaagggaaagcaagcctcataccaaaagagaag
gaaggagtgaatgagggagatgaaggaccatctgtggaagtgaaagaaaaggagagcaaa
gagggagcggaggtggattccagcaaggaaacttccagctctctggaaacagtagacaac
aaacctgctggggacaagtattcccccaaagagctccttgcactgctgaagtgcgttgag
gctgatatagccaattacgaggtgtctctaaaagaggaagtggaaaagagaaagaaatac
aaaatcgatgatcagaggaggactcataactatgatgaattcatctgtacctttatatca
atgctggcccaagaaggcatgttggccagtctcgtggagcaaaacatttcagttcgccgt
cggcagggcgtgagcatcggccgtttgcacaaacagaggaagcctgaccgcaggaaacgc
tctcggccttacaaagccaagaggcagtga

DBGET integrated database retrieval system