KEGG   Takifugu rubripes (torafugu): 101071490Help
Entry
101071490         CDS       T02386                                 

Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    101071490
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101071490
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101071490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 334 aa AA seqDB search
MSQLAFTFTRRLHHLHQQRSRVGLIGAPFAKGQPRPGVDRGPDLIRAAGLLNRLQEQGNE
VKDYGNLTFEELEEDEPVGGVKHVRAVGGANQRLSEAVRAVKMDGRVSVMLGGDHSLAIG
SIHGHAAAVGPLSVVWVDAHADVNTALTTPTGNLHGQPMSFLLHELRSKIPVLPNFSWFT
PCVSAKDLVYIGLRDLDPGEHYILRLLGAKVFSMTEVDRLGIGRVMEETCDHLCTRKKPV
HLSYDVDAIDPAVTPATGTPVPGGLTYREGVYITEQLCQTGLLSGVDMVEVNPLRGPTEH
AIQSTVNTAVDLLLGCFGRRREGNHPSDFLLPGP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactcgcgtttacgttcacgcggcgtcttcatcatcttcatcagcagaggagc
cgagtgggactgataggagcgccttttgccaaaggacagcctcgcccaggggtggacaga
ggaccggacctaatccgagctgcaggactgctgaatcggctgcaggaacagggcaatgaa
gtgaaggattatgggaacctgacttttgaggagttagaagaggacgagccagtaggcgga
gtcaagcatgtgcgcgcagtgggcggggccaaccagaggctgtcagaggcggtgcgtgct
gtgaagatggatggacgcgtgtcggtgatgctgggaggagaccacagtttggccatcggc
tccatccacggacacgcggcggccgtcgggccgctttccgtcgtgtgggttgacgcccac
gctgacgtcaacacagcgctgaccacgcccaccggaaacctccacggacagccgatgtcc
ttcctgctgcacgagctgcgctcaaagattcccgtgttgccaaacttctcgtggttcaca
ccgtgcgtctctgccaaagatctggtctacattggtttgagagacctggacccaggagag
cattacatcttgaggctcctgggcgcaaaggtgttctccatgacagaggtggatcgactg
ggtatcggcagagtcatggaggagacgtgcgatcacctctgcacgcggaagaagccagtc
cacctgagctatgatgtagatgccatcgacccggccgttaccccggcaacagggacgcct
gttcctggagggctgacctatagagagggagtgtacatcaccgaacagttgtgccagaca
ggtcttctctcaggggtcgacatggtggaggtgaacccgctgagaggtccgaccgaacac
gccatccagtctacggtcaacaccgccgtcgacctgctgctcggctgtttcggaagacgg
cgtgaaggaaaccatccatcggattttcttctgccagggccttaa

DBGET integrated database retrieval system