KEGG   Takifugu rubripes (torafugu): 101071490Help
Entry
101071490         CDS       T02386                                 

Definition
(RefSeq) arginase-1-like
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00220  Arginine biosynthesis
tru00330  Arginine and proline metabolism
tru01100  Metabolic pathways
tru01230  Biosynthesis of amino acids
Module
tru_M00029  Urea cycle
tru_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    101071490
   00330 Arginine and proline metabolism
    101071490
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101071490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 101071490
NCBI-ProteinID: XP_003961253
Position
1
AA seq 334 aa AA seqDB search
MSQLAFTFTRRLHHLHQQRSRVGLIGAPFAKGQPRPGVDRGPDLIRAAGLLNRLQEQGNE
VKDYGNLTFEELEEDEPVGGVKHVRAVGGANQRLSEAVRAVKMDGRVSVMLGGDHSLAIG
SIHGHAAAVGPLSVVWVDAHADVNTALTTPTGNLHGQPMSFLLHELRSKIPVLPNFSWFT
PCVSAKDLVYIGLRDLDPGEHYILRLLGAKVFSMTEVDRLGIGRVMEETCDHLCTRKKPV
HLSYDVDAIDPAVTPATGTPVPGGLTYREGVYITEQLCQTGLLSGVDMVEVNPLRGPTEH
AIQSTVNTAVDLLLGCFGRRREGNHPSDFLLPGP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactcgcgtttacgttcacgcggcgtcttcatcatcttcatcagcagaggagc
cgagtgggactgataggagcgccttttgccaaaggacagcctcgcccaggggtggacaga
ggaccggacctaatccgagctgcaggactgctgaatcggctgcaggaacagggcaatgaa
gtgaaggattatgggaacctgacttttgaggagttagaagaggacgagccagtaggcgga
gtcaagcatgtgcgcgcagtgggcggggccaaccagaggctgtcagaggcggtgcgtgct
gtgaagatggatggacgcgtgtcggtgatgctgggaggagaccacagtttggccatcggc
tccatccacggacacgcggcggccgtcgggccgctttccgtcgtgtgggttgacgcccac
gctgacgtcaacacagcgctgaccacgcccaccggaaacctccacggacagccgatgtcc
ttcctgctgcacgagctgcgctcaaagattcccgtgttgccaaacttctcgtggttcaca
ccgtgcgtctctgccaaagatctggtctacattggtttgagagacctggacccaggagag
cattacatcttgaggctcctgggcgcaaaggtgttctccatgacagaggtggatcgactg
ggtatcggcagagtcatggaggagacgtgcgatcacctctgcacgcggaagaagccagtc
cacctgagctatgatgtagatgccatcgacccggccgttaccccggcaacagggacgcct
gttcctggagggctgacctatagagagggagtgtacatcaccgaacagttgtgccagaca
ggtcttctctcaggggtcgacatggtggaggtgaacccgctgagaggtccgaccgaacac
gccatccagtctacggtcaacaccgccgtcgacctgctgctcggctgtttcggaagacgg
cgtgaaggaaaccatccatcggattttcttctgccagggccttaa

DBGET integrated database retrieval system