KEGG   Takifugu rubripes (torafugu): 101071532Help
Entry
101071532         CDS       T02386                                 

Gene name
comp
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101071532 (comp)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101071532 (comp)
  Cellular commiunity
   04510 Focal adhesion
    101071532 (comp)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101071532 (comp)
  Exosomal proteins of colorectal cancer cells
   101071532 (comp)
  Exosomal proteins of bladder cancer cells
   101071532 (comp)
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101071532 (comp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 742 aa AA seqDB search
MCPALTRHQGVWVGVPEDGEIISQIKMTNIALAEIKELLKQQLKEVGFLKNAMMECEACG
MGGLQPEPSCVPNPCHPGVECTVTPEGFQCGSCPDGTEGNGTHCTDVDECSVKPCHMGVR
CINTSPGFRCGSCPAGYRGSQVQGVGLAYAVANKQVCQDIDECQNNSAGCVEDSVCMNTP
GSFRCGPCKTGYVGDQQSGCKPERTCGNGLPNPCHPNGECIVHRDGTIECRCGVGWAGNG
YLCGSDIDIDDFPDEKLNCPERNCNKDNCLKVPNSGQEDADSDGIGDACDDDADGDGIPN
TQDNCVLVPNMDQRNVDEDDFGDACDNCPGVKNDDQRDTDVDKFGDECDEDIDGDGILNH
LDNCKRVPNVDQKDRDGDKVGDACDSCPYVPNPDQSDADNDLIGDPCDTNKDSDGDGHQD
SRDNCPAVINSSQLDTDKDGKGDECDDDDDDDGIPDLLPPGPDNCRLIPNPLQEDSNGDG
VGNVCDKDFDNDTIVDTIDVCPENAAVTLTDFREYQTVVLDPEGDVQIDPNWVVLNQGRE
IVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQVEQ
NYWQASPFRAVAQPGIQLKAVKSTTGPGEYLRNALWHTGDTGDQVKLLWKDARNIGWKDK
TSYRWFLQHRPADGYIRVRFFEGPQLVVDTGVIIDATMRGGRLGVFCFSQENIIWANLRY
RCNDTLPEDFDNYRAQQVQLVV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtgccccgcgctcacacggcaccagggggtgtgggtgggggttcctgaggatggagaa
atcatcagtcaaattaaaatgaccaacattgcattggctgagatcaaagagctcctgaaa
caacagctcaaagaggtcggtttcctgaagaatgccatgatggagtgtgaagcctgcggg
atgggggggttgcagcctgagccctcctgtgtgcctaatccctgccacccaggggtggag
tgtacggtgacccctgagggtttccagtgcggttcctgtcctgacgggacggagggcaac
ggtacgcactgcaccgatgtggatgagtgttccgtgaagccctgtcacatgggcgtgcgc
tgcatcaacacgtccccgggtttccgttgcggctcctgtcctgcgggataccgggggtcg
caggtccagggtgtgggcctagcttacgccgttgccaacaaacaggtgtgtcaggatatt
gacgagtgccaaaacaacagtgcgggatgtgtggaggactcggtctgcatgaacacccct
ggctcgttcaggtgtggcccctgtaagacgggctatgttggggatcagcagagtggctgc
aagccagagagaacctgtgggaatggcctacccaacccctgccaccccaacggcgaatgc
atcgtccaccgagatggcacaatcgagtgtcggtgtggggtaggatgggccggcaacggc
tacctgtgtgggtctgacattgacatcgatgacttccccgacgagaagctgaactgccct
gagaggaactgcaacaaggataattgcctcaaggtgccaaactcgggccaagaagatgct
gacagcgatggaattggagacgcctgcgacgacgatgcagatggagacgggatccccaac
acgcaggacaactgcgtgttggtgccaaacatggaccaacggaacgtggacgaggacgac
tttggggacgcctgcgacaactgccccggcgtaaaaaacgacgaccagagagacacggac
gtagacaaattcggcgacgagtgcgatgaggacatcgatggtgacggaattctcaatcac
ctggacaactgcaaacgagtccccaatgttgaccagaaggatcgggacggagacaaagtg
ggagacgcatgtgacagctgtccttacgttccaaaccctgatcagagtgacgcggacaat
gatctgattggcgacccctgtgacaccaacaaggacagcgatggcgacggccaccaggac
tctcgggacaactgtccggcggtcatcaacagctcccagctggacaccgacaaggacgga
aagggggacgagtgtgacgacgacgacgatgatgacggtatcccggacctgctgcctccc
ggcccagataactgccgtttgatcccgaaccctctgcaggaggactccaacggggacggc
gtggggaacgtgtgtgacaaggacttcgacaatgacaccatcgttgacactatagacgtg
tgtcctgagaatgccgcggtcacgctcaccgacttcagggagtaccagactgttgttctg
gatccagagggagacgtgcaaatcgatcccaactgggtggtgctgaaccagggaagagag
attgttcagaccatgaacagcgacccaggattggctgttggttacactgctttcagcggc
gtggactttgaagggacgttccacgtgaacacggtgacggatgacgactatgccgggttc
atcttcggctaccaggacagttccagcttctacgtggtgatgtggaagcaggtggagcag
aactactggcaggcaagcccgttccgagccgtggcacaaccaggcatccagctaaaggcg
gtcaaatcaacgacgggccctggcgagtacttaagaaacgcgctgtggcacaccggcgat
acgggcgaccaggtcaagcttctgtggaaggacgcccgcaacatcggctggaaggacaaa
acctcctaccgctggttcctgcaacaccggcccgccgacggctacatcagagttcggttc
ttcgagggcccacagctggtggtggacacgggcgtcatcatagatgccaccatgagagga
ggccggctcggagtcttctgtttctcacaggagaacatcatctgggcgaacctgcgctac
cgctgcaacgacactctgcctgaggacttcgacaactacagagctcagcaggtccagctg
gtagtctga

DBGET integrated database retrieval system