KEGG   Takifugu rubripes (torafugu): 101071532Help
Entry
101071532         CDS       T02386                                 

Definition
thrombospondin-4-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101071532
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101071532
  Cell communication
   04510 Focal adhesion
    101071532
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101071532
  Exosomal proteins of colorectal cancer cells
   101071532
  Exosomal proteins of bladder cancer cells
   101071532
Heparan sulfate/heparin binding proteins [BR:tru00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  101071532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 742 aa AA seqDB search
MCPALTRHQGVWVGVPEDGEIISQIKMTNIALAEIKELLKQQLKEVGFLKNAMMECEACG
MGGLQPEPSCVPNPCHPGVECTVTPEGFQCGSCPDGTEGNGTHCTDVDECSVKPCHMGVR
CINTSPGFRCGSCPAGYRGSQVQGVGLAYAVANKQVCQDIDECQNNSAGCVEDSVCMNTP
GSFRCGPCKTGYVGDQQSGCKPERTCGNGLPNPCHPNGECIVHRDGTIECRCGVGWAGNG
YLCGSDIDIDDFPDEKLNCPERNCNKDNCLKVPNSGQEDADSDGIGDACDDDADGDGIPN
TQDNCVLVPNMDQRNVDEDDFGDACDNCPGVKNDDQRDTDVDKFGDECDEDIDGDGILNH
LDNCKRVPNVDQKDRDGDKVGDACDSCPYVPNPDQSDADNDLIGDPCDTNKDSDGDGHQD
SRDNCPAVINSSQLDTDKDGKGDECDDDDDDDGIPDLLPPGPDNCRLIPNPLQEDSNGDG
VGNVCDKDFDNDTIVDTIDVCPENAAVTLTDFREYQTVVLDPEGDVQIDPNWVVLNQGRE
IVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQVEQ
NYWQASPFRAVAQPGIQLKAVKSTTGPGEYLRNALWHTGDTGDQVKLLWKDARNIGWKDK
TSYRWFLQHRPADGYIRVRFFEGPQLVVDTGVIIDATMRGGRLGVFCFSQENIIWANLRY
RCNDTLPEDFDNYRAQQVQLVV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtgccccgcgctcacacggcaccagggggtgtgggtgggggttcctgaggatggagaa
atcatcagtcaaattaaaatgaccaacattgcattggctgagatcaaagagctcctgaaa
caacagctcaaagaggtcggtttcctgaagaatgccatgatggagtgtgaagcctgcggg
atgggggggttgcagcctgagccctcctgtgtgcctaatccctgccacccaggggtggag
tgtacggtgacccctgagggtttccagtgcggttcctgtcctgacgggacggagggcaac
ggtacgcactgcaccgatgtggatgagtgttccgtgaagccctgtcacatgggcgtgcgc
tgcatcaacacgtccccgggtttccgttgcggctcctgtcctgcgggataccgggggtcg
caggtccagggtgtgggcctagcttacgccgttgccaacaaacaggtgtgtcaggatatt
gacgagtgccaaaacaacagtgcgggatgtgtggaggactcggtctgcatgaacacccct
ggctcgttcaggtgtggcccctgtaagacgggctatgttggggatcagcagagtggctgc
aagccagagagaacctgtgggaatggcctacccaacccctgccaccccaacggcgaatgc
atcgtccaccgagatggcacaatcgagtgtcggtgtggggtaggatgggccggcaacggc
tacctgtgtgggtctgacattgacatcgatgacttccccgacgagaagctgaactgccct
gagaggaactgcaacaaggataattgcctcaaggtgccaaactcgggccaagaagatgct
gacagcgatggaattggagacgcctgcgacgacgatgcagatggagacgggatccccaac
acgcaggacaactgcgtgttggtgccaaacatggaccaacggaacgtggacgaggacgac
tttggggacgcctgcgacaactgccccggcgtaaaaaacgacgaccagagagacacggac
gtagacaaattcggcgacgagtgcgatgaggacatcgatggtgacggaattctcaatcac
ctggacaactgcaaacgagtccccaatgttgaccagaaggatcgggacggagacaaagtg
ggagacgcatgtgacagctgtccttacgttccaaaccctgatcagagtgacgcggacaat
gatctgattggcgacccctgtgacaccaacaaggacagcgatggcgacggccaccaggac
tctcgggacaactgtccggcggtcatcaacagctcccagctggacaccgacaaggacgga
aagggggacgagtgtgacgacgacgacgatgatgacggtatcccggacctgctgcctccc
ggcccagataactgccgtttgatcccgaaccctctgcaggaggactccaacggggacggc
gtggggaacgtgtgtgacaaggacttcgacaatgacaccatcgttgacactatagacgtg
tgtcctgagaatgccgcggtcacgctcaccgacttcagggagtaccagactgttgttctg
gatccagagggagacgtgcaaatcgatcccaactgggtggtgctgaaccagggaagagag
attgttcagaccatgaacagcgacccaggattggctgttggttacactgctttcagcggc
gtggactttgaagggacgttccacgtgaacacggtgacggatgacgactatgccgggttc
atcttcggctaccaggacagttccagcttctacgtggtgatgtggaagcaggtggagcag
aactactggcaggcaagcccgttccgagccgtggcacaaccaggcatccagctaaaggcg
gtcaaatcaacgacgggccctggcgagtacttaagaaacgcgctgtggcacaccggcgat
acgggcgaccaggtcaagcttctgtggaaggacgcccgcaacatcggctggaaggacaaa
acctcctaccgctggttcctgcaacaccggcccgccgacggctacatcagagttcggttc
ttcgagggcccacagctggtggtggacacgggcgtcatcatagatgccaccatgagagga
ggccggctcggagtcttctgtttctcacaggagaacatcatctgggcgaacctgcgctac
cgctgcaacgacactctgcctgaggacttcgacaactacagagctcagcaggtccagctg
gtagtctga

DBGET integrated database retrieval system