KEGG   Takifugu rubripes (torafugu): 101071607Help
Entry
101071607         CDS       T02386                                 

Definition
ras-related C3 botulinum toxin substrate 2-like
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101071607
   04310 Wnt signaling pathway
    101071607
   04370 VEGF signaling pathway
    101071607
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101071607
  Cell communication
   04510 Focal adhesion
    101071607
   04520 Adherens junction
    101071607
GTP-binding proteins [BR:tru04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101071607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTKVKKKSCLLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctatcaaatgtgtggtcgtgggagatggagccgtgggaaaaacatgcttactc
atcagctacacaaccaatgccttccctggggagtacatccccactgtatttgacaactac
tcagctaatgtgatggtagacagcaaaccagttaacctgggcctctgggatacagctggg
caggaagactatgacaggctccgcccactctcctacccacagacggatgtttttttgatc
tgtttctccctcgtgagtccagcatcctatgaaaacgtcagagctaagtggtaccctgag
gtccgccaccactgcccctccacacccatcatcctggtaggcacaaagctggatctaagg
gatgagaaagaaacaattgagaagctgaaagaaaagaagctggctccgatcacctatcct
cagggcctggctctggccaaggagatagatgcagtgaaatacctggagtgctcggccttg
acccagcggggtctgaagactgtgtttgatgaagccattcgggcagtcctctgcccacag
cccacaaaggtcaagaaaaagtcgtgcttgctgctgtaa

DBGET integrated database retrieval system