KEGG   Takifugu rubripes (torafugu): 101071621Help
Entry
101071621         CDS       T02386                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tru00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 1536 aa AA seqDB search
MLPQHLKQIRVLMLNDKENLQRTLFRLEQGFELQFRLGPSLQGKDVLLYTNYPLEGQPYK
RNKFRVLEWNNPTGREDDSDKFCSLDLKIAGSYEYYFGHGDTEQSGRGYIVVDPVLRVGA
DNHVLPLDCITIQTYLSKCLGHLDDWPDRLRVAKEAGYNMIHFTPLQTLGESRSCYSLAD
QLTFNPEFSPQGQRYTWADVGALVEKLKTDWGMLCITDVVYNHTAANSVWIKEHPECGYN
LVNSPHLRPAWVLDRAIWHLTTRVADGRYKEQGLPADITNESHLSAIRSVLWKDVFPQIK
LWEFFQVNVATAVEDFRTLLQNGSKPDHSKTGGKKGLKVIQDPRYRRYSNNVDMDSALET
FIPVSFSPQHIEECCGWLRQKLDELNKEQYHIVHQHQEQAVNCIVGNVVYERLAEHGPKL
GPVSRKNPMVTRYFTFPYPEMTLEQELLLLNQPSKTCHFLAHNGWVMGDDPLRNFAEPGS
NVYLRRELICWGDSVKLRYGKGPEDCPYLWAHMQKYTEITAQYFNGVRLDNCHSTPLHVA
EFMLDIARRVCPNLYVVAELFTGSEELDNVFVTKLGISSLIREAMSAGDSHEEGRLVYRY
GGEPVGAFFQPSLRPLMPSIAHAMFLDVTHDNECPIQLRSALDSLPSSAMVSMACCATGS
TRGYDELVPHQISVVKEERIYPKWNPSAAPSSSSEVGFQTGIIAGKLALNKLHKELAAQG
FIQVYVDQVDADIVAVTRHCPSTHQSVVSVCRTAFWDPKTHQYDTNVPPMFIPGKIEEVV
LEARTVERHAGSYKRDDKYINGMPEYSVEIKEHLPLEESTVVKKAGVTSRGPSEFVQEIN
FQKLTPGSVIAFRVSLDPKAQKMVGALRFYLSQFSPKYRKGSLTEENPPEALQKPLAQLM
SQLTLADLNILLFRCESEEQEDGGGCYSIPGWETLKYAGLQGLISVFANIRPNNDLGHPV
CANLRQGDWLIDYVSNRLLHREGPLAQVGQWLAAMFSYLKHIPRYLIPCYFDAILVSTYT
TALDATYKLMSSFVQNGSTFVRHLALGSVQMCGVGRFPALPPISTTIVDVPYRISPVTDQ
KEQCCVSLAAGLPHFSAGIFRCWGRDTFIALRGLMLLTGRQVEARNIILAFAGTLRHGLI
PNLLGEGRCARYNCRDAIWWWLQCIQDYANNVSQGEDILSCPVTRMYPNDDCEPCRPGEV
EQPLYDVIQEALQRHLQGISFREQNAGPKIDMNMRDEGFNVNIKVDVATGFVSGGNRFNC
GTWMDKMGESERARNKGMPATPRDGAAVEIVGLSKSAVRWLVELHAKGLFPYTGTKVHRD
GQELFVSYSQWNQQLQQAFEAAFWVSEDPQDSNEKNPELVHKKGIYKDSYGASSPWCDYQ
LRPNFTIAMVVAPELFTAERAWTALSVAEKKLLGPLGMKTLDPDDMVYCGVYDNALDNDN
YNLARGFNYHQGPEWLWPVGYFLRAKLYFAKKLGEEIYSETVTLIKSVLSRHYTHLERSP
WKGLPELTNENGQYCPFSCETQAWSLATLLEVLYEL
NT seq 4611 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctcagcatttgaagcagattcgagtcctaatgctcaacgacaaggagaactta
cagaggacattgttcagactcgaacaggggtttgagctgcagttccgccttggtcccagc
ctgcaggggaaggatgttttgctgtacaccaactatcccttagaggggcagccgtacaaa
cgtaacaaattccgcgttttggagtggaacaacccaacggggcgggaggatgactctgat
aagttctgttctttggacctcaagatagctggatcctatgaatactactttggacatgga
gacactgagcagtcaggaaggggatacatcgtcgtggacccagtcctccgcgttggagca
gacaatcatgtactcccgttagattgcatcaccatccagacctacttgtccaaatgtctg
ggtcacctggatgactggcctgatagactgagggtagctaaggaggcaggatacaatatg
attcacttcacgccactacagactctgggagagtcccggtcctgttattctttggcagac
cagctgacctttaaccctgagttcagtccacagggtcagcgctacacctgggctgatgtg
ggggcactggtggaaaagttgaagacagactggggcatgctatgtattacagatgtagtg
tacaatcatactgctgctaacagtgtttggatcaaggaacatcctgagtgtggttacaac
ctggtcaactccccccacttgcgtccagcctgggtcttagatcgagctatctggcattta
acgacaagagtagctgatggacgctacaaagagcaaggacttcctgcagacatcaccaat
gagagtcacctcagtgccattcgcagtgtgttgtggaaagacgtgtttcctcagatcaaa
ctgtgggagttctttcaggttaatgtggccactgctgtggaggacttcagaactctgctc
caaaatggctcgaaaccagatcacagtaaaactggaggtaagaaaggcctgaaggtcatt
caggatccacgttatcgtcgttatagcaacaacgtggacatggactcagctctggaaaca
tttatacctgtcagtttttccccacagcacatagaggagtgctgtggctggctgaggcag
aagctggatgagctgaataaagaacagtaccacatcgtgcaccagcaccaagagcaggct
gtcaactgtattgtgggaaatgttgtttatgagcgtctggcagaacacggccccaaactt
ggtcccgttagcaggaagaaccctatggtaaccaggtattttacttttccgtatccggaa
atgactctggagcaggagctgctgctgctgaaccaaccaagcaagacatgccatttccta
gctcacaatggttgggtgatgggtgatgaccctctgcgcaactttgcggaacctggctct
aatgtgtacttgcgtcgggagcttatttgctggggggacagcgtgaagctccgctatggg
aagggccctgaagactgcccctacctgtgggcccacatgcagaaatacactgagattact
gcccagtacttcaatggagtcagactggacaactgtcactcaacaccattacatgtggct
gagttcatgctggacattgccagaagagtgtgtcctaacctgtatgttgtggctgagctg
ttcaccggcagcgaagagctggataatgtcttcgtaaccaaactaggcatctcatcgctg
atacgagaggccatgtcagctggtgacagtcatgaagagggccgactggtgtaccgttac
ggaggtgagcctgtgggagcgttcttccagcccagtcttcgcccactaatgccctctatt
gcccatgcgatgttcttggatgttacccatgacaacgagtgccccatacagctgcgttca
gctctggactccctccccagttctgcgatggtctctatggcctgctgtgctactggctcc
accagaggatatgatgaattagttccccatcagatttctgtggtgaaggaggagcgtatt
tacccaaagtggaacccctcagcagcccctagctccagcagtgaggtcggattccagact
ggcattatagcaggaaagctggctctgaacaagctacacaaagagctggctgcccaggga
ttcatacaggtatacgttgaccaggttgatgcagatatcgtagctgtcactcgccactgt
cccagcacgcatcagtctgtggtatcagtgtgtcgaaccgccttctgggaccccaaaacc
catcagtatgacaccaatgtccctcccatgttcatacctggtaagattgaggaagtggtg
ctggaggcaagaacggtggaaaggcatgctgggagttataagagagatgacaagtacatc
aatggcatgcctgaatacagtgtggaaataaaggaacatcttcctctagaagaaagtaca
gtggtgaagaaagctggagtcacatctagaggtccatccgagtttgttcaggaaatcaac
ttccagaagctgacaccaggcagcgtcatcgcctttagggttagcctagaccctaaggcc
cagaagatggtgggggcactaagattctatctttcccagttcagcccaaaatacaggaag
ggcagcttgactgaggaaaacccacctgaggctttgcagaaacctctggctcagctgatg
tctcagctgaccctagcggacctcaacatcctgctttttcgctgtgaatcagaggaacaa
gaagatggtggtggctgttacagcatcccaggatgggagaccttgaaatatgcagggctg
cagggtctgatatcagtgtttgctaacattcgacccaacaatgacctgggccatcctgtg
tgtgccaacctgcgacagggagactggctcattgactatgtctcaaacagactgttgcac
cgagagggacctctggcgcaggttggccagtggttggcagccatgtttagctacctaaaa
cacatcccacgctacctcattccctgttactttgatgccatcttggtttcaacctacaca
acagctctggatgcgacctataaactcatgtcaagctttgttcagaatggctccaccttt
gtccgtcacttggctcttggctcggttcagatgtgtggtgttgggcgcttccccgccctc
cctccaatttctaccacaattgtggatgttccgtatcgcatcagtccagtcacagaccag
aaggagcagtgctgcgtctcattggctgcaggacttcctcatttctctgctgggattttc
cgttgctggggcagagacactttcattgctctcagaggactaatgctactcactgggaga
caagtggaggctcgcaacatcatcctggcttttgctggaacgctgcgacatggtctgatc
cccaacctgctgggggagggccgctgtgctcgctacaactgccgcgatgccatttggtgg
tggctgcagtgcatccaggactatgccaacaatgtttctcaaggtgaggacatcctcagc
tgccctgttacacgcatgtatcccaatgatgactgtgaaccctgcagacctggagaagtg
gaacagccgctgtatgacgtgatccaagaggctctacagcgccacctgcagggcatttcc
ttcagagagcaaaacgctggacccaagatagatatgaacatgagagatgaagggttcaac
gtgaacattaaggtggacgtggccacaggtttcgtgagtggagggaatcgctttaactgc
ggcacatggatggacaaaatgggagagagtgagagagcgaggaacaaaggcatgccagcc
actccaagagacggtgcagcagtggagatcgttggcctcagtaaatcggctgttcgctgg
ctcgttgagctccacgccaaaggactgttcccttacactggaactaaagtgcaccgagat
ggtcaggagctgtttgtgtcatactcccagtggaatcagcagctccagcaggcctttgaa
gctgctttctgggtgtcagaagacccacaggactccaatgagaaaaatcctgagctggtt
cacaaaaaaggcatctacaaggacagttatggggcctcaagcccctggtgcgactaccag
ctgagacctaatttcactattgccatggtcgtggccccagagctgtttacagcagagagg
gcatggaccgctctctcagtggctgagaagaaactactgggaccactgggaatgaagact
cttgacccagatgacatggtgtactgtggtgtttatgacaacgctctagacaatgacaac
tataacctggccagaggcttcaactaccaccaaggaccagagtggctctggccagttgga
tacttcctgcgtgctaaactctattttgccaaaaagcttggagaagaaatctacagtgaa
actgtgaccctgatcaaaagtgttctgtcccgacattacactcacttggagcgctctccc
tggaagggtctcccagagctgaccaatgagaacggccagtattgtccatttagttgtgag
acccaggcctggtccctggccacactactggaggtcctctatgaactgtga

DBGET integrated database retrieval system