KEGG   Takifugu rubripes (torafugu): 101071702Help
Entry
101071702         CDS       T02386                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101071702
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     101071702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 480 aa AA seqDB search
MACAPWPKGKKLVHLDLKGAPPRVEYLHKLIELFSQLGADGLLVEYEDMFPYERELKLLQ
ATTHPAYSPEEVLSMQEFAKSKAIEIIPLVQTFGHMEFVLKHRSLWNLREVPYCVGTLNP
HKEEGVRLVMEMLRQVVKLHPGLNTLHIGADEVYTLGEGDESKLWLALPNRTVEKLFLSH
VTKLARAIKEEWPHMTIIMWDDMMRGMSQETLIASDLVGLVQPMLWNYTPDLDVEITVSL
LEKYHSAGMTELWAASSFKGSTNVYTCVPSTVRHVDNHLQWLRVAASLSAGVTLQGIAIT
GWQRYDHLSVLCELMPVALPSLASCLQTLFLGHFNSEAQFAVTEKLGISSVEVEEIGRSS
AVDSMFPGRRLAELTVELNTLLNSDDIRFFENDMFIRGWFSPYHRRMKLVTPLITMQVHS
KASGILTTLQQKVDTMREEMMCLFHEATVQEWMEEHVHPVMAPLRRITEEIRACVKEMVP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtgcgccttggcctaaaggaaagaaattagttcatcttgatttgaaaggagcc
cctccaagagtagagtaccttcataagctgatcgagttgttctctcaactgggagcagat
ggcctgctggtggagtatgaggacatgtttccatatgagagggagctgaagctgttgcag
gctacaacgcatcctgcttacagcccagaggaggtactctctatgcaggaatttgcgaaa
tcaaaggcaattgaaataattccacttgtccagacttttggtcacatggagtttgtgctg
aagcatcgatcgttgtggaatctaagagaggtgccatattgtgtgggaacccttaaccct
cacaaagaggagggtgttaggctagtgatggagatgctgagacaagtggtgaagcttcat
ccaggcctgaacacactacacattggagctgatgaggtgtacacccttggtgagggggat
gagtctaaattgtggttggctttgcccaaccgtacagtcgagaagcttttcctgagtcat
gtgacgaagctggccagggccatcaaggaggaatggcctcacatgaccatcataatgtgg
gatgacatgatgagaggcatgagccaggaaacattaatagctagtgatctagtgggactg
gtccagccaatgttgtggaactacacccctgacctggatgtggaaatcacagtgtctctg
ttggagaagtaccacagtgctggaatgacagagctatgggcggccagctccttcaaaggc
tccaccaacgtttacacatgcgtgcccagcacggtcagacacgtggataatcatctgcag
tggctgagggtggctgcttctttatctgctggtgtaaccctgcagggaattgctatcaca
ggctggcagaggtatgaccacctgtcagtgctgtgtgaactgatgcctgtagctcttcca
tcattagcatcgtgtctccaaacgctcttccttggtcatttcaattctgaggcccagttt
gcagttactgaaaagctgggcatttcctcagttgaggtagaggaaataggaaggtcttct
gcggttgattcaatgttcccaggaaggaggctggccgagctgactgtggagctcaatacg
ctactgaactctgacgacatacgattctttgaaaatgacatgttcataagaggatggttc
agcccgtaccatcggcggatgaagctggtaactcccctcatcaccatgcaggttcacagc
aaagcctcagggattctaaccacattacaacagaaggtggacaccatgagagaggagatg
atgtgtcttttccatgaggcaacagttcaagagtggatggaggaacacgtccatcctgta
atggcacctctacgaaggataacagaggagattagggcatgtgtgaaggaaatggtgcct
tga

DBGET integrated database retrieval system