KEGG   Takifugu rubripes (torafugu): 101071747Help
Entry
101071747         CDS       T02386                                 

Definition
[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial-like
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     101071747
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   101071747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 428 aa AA seqDB search
MRSGLACAAVEMLSAATCRSRPRLCSLLLAPLTKTVPPTWTTGSFRCRSTSSMQGFSELA
RERSKTVTSFYNQSAIDISAEKASVRLTLATLLYSGKSPDGHHILSSAKYLHKELPVRIA
HRIKGFRSLPFIIGCNPTILQVHELYIRAYHMLSDFPQIEDQDVEARFCKLVQQLLDDHK
DVVTMLAQGFKECRKHMTDEAVLRSFLDSTLCSRLGIRMLATHHLALHEDNPDFVGIICR
RLSPKKIIEKWVDFARRLCEHQYGNSPRVRINGHVAARFPFIPLPLDYILPELLKNAMRA
TMESHLNTPYNVPDVIITIANNDIDFVIRISDRGGGIPHNIVDKVMDYHFSTAEESAQDP
RMSSLFDNITNSGNQSNPMHGFGFGLPTSRAYAEYLGGSLSIQSMQGIGTDVYLRLRHID
GKGESFRV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgggactcgcttgtgcagcggtggagatgctgagcgctgccacctgcagatcc
agaccgaggctctgcagcctcctgctggcccccctcaccaaaacagttccaccgacatgg
accacaggaagcttcagatgtcggtctacttcctcgatgcagggcttctcagagctggcg
agagagcgctccaagactgtgacgtcgttttacaaccagtcggcaatcgatatttcggca
gaaaaggcctcggtgcgtctgacactggccaccctgttgtattctgggaaatctcctgat
ggccaccatattctgagcagtgccaaatacctgcacaaggagcttccagtacgaattgca
catcgcatcaaaggtttccgcagtctgcctttcatcattggctgcaatcccaccatcctg
caagtgcatgagctctacatcagagcgtatcacatgctcagtgacttcccccagattgag
gatcaagatgtggaggcgcgcttctgtaaacttgttcagcagcttctggatgaccataaa
gacgtggtgaccatgttggctcaaggattcaaggagtgtcgtaaacacatgacggacgag
gctgtcctccgtagcttcctggactcaacgctttgctctcgcctgggaatccgaatgttg
gccacacatcatctggctctgcacgaagacaacccggactttgttgggatcatctgcagg
cgactgtctcctaaaaagatcattgagaagtgggtggactttgccaggcgtctgtgtgaa
catcagtatggaaactctcccagagtgagaatcaacggtcacgtggccgctcgcttcccc
ttcatcccgctgcctctggattatatcctgcctgagcttttgaagaacgccatgagggcc
accatggagagccacttgaacaccccgtacaacgtgcctgatgtgatcatcaccatcgcc
aataacgacattgattttgtcatcaggatttcagaccgaggaggtggaatccctcacaac
attgtagacaaagttatggattaccacttcagcaccgccgaggaaagtgctcaggatcct
cgcatgagcagcctgttcgacaacatcactaacagtgggaaccagtccaaccccatgcat
gggtttgggttcggcttaccgacatcccgggcctatgctgaatatcttggaggttctctg
tccattcagtcgatgcagggcattggtacagacgtatacctgcgactgcgccacatcgac
ggaaaaggagagagtttcagagtgtga

DBGET integrated database retrieval system