KEGG   Takifugu rubripes (torafugu): 101071896Help
Entry
101071896         CDS       T02386                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101071896
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101071896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 512 aa AA seqDB search
MALELRERFPEVLDLVRRCGQRPVVDHRGVIHLTGPAAMEATRRNVQQRGNKETSERTEP
PAQWGRAWEVDWFSLISVLGLLCFAPFIVFYFVMACDQHQCSLSQPLLQLLRGDASLLSI
WERTASFSWSAAKIYSVWVAFQVFLYMCVPDVTHKVIPGYVGGVQDGARTPAGLINKYEI
NGLQCWLITHALWFANAHHFRWFSPTIIFDNWIPLMWCANILGYAVSTFAFTKAYLFPTN
SEDWXVQFTGNFVYDFMMGIEFNPRVGKWFDFKLFFNGRPGIVAWTLINLSYMAKQQELY
GHVTNSMILVNVLQAIYVLDFFWNEAWYLKTIDICHDHFGWYLGWGDCVWLPYLYTLQGL
YLVYHPVQLSNLHALAVLLLGLVGYYIFRSTNHQKDLFRRSNGSCTIWGRKPTFIECSYR
SGDGEVHHSKLLTSGFWGVARHFNYTGDLMGSLAYCAACGFGHLLPYFYIIYMTILLVHR
CVRDEHRCSSKYGKDWKRYTDAVPHRLIPGIF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggctctggaactccgagagaggttcccagaagttcttgacctggtgcgcagatgtggc
cagagaccggtggtggatcacagaggcgtgatccacctgactggtccagcagcgatggag
gcgaccaggcggaacgtccagcagagaggcaacaaggagacatcagagcgaacggagccg
ccggcccagtggggcagagcgtgggaggtggactggttctccctgatctcggtgctgggc
ctcctttgctttgcgcctttcatcgtcttttactttgtgatggcgtgcgaccagcaccag
tgctccctcagccagccgctgctgcagctgctccgcggagacgccagcctgctgtccatc
tgggagcgcacggcctccttctcctggtcagctgccaagatctactccgtctgggtggcc
ttccaggtgttcctgtatatgtgcgtccctgacgtcactcacaaggtgatccccgggtat
gtcgggggagtgcaggacggagcgcgaactcctgctgggctaattaacaagtacgagatt
aacggcttgcagtgctggctcatcactcatgcgctgtggttcgccaacgcccaccatttc
cgctggttttctcccaccatcatcttcgacaactggatccccctcatgtggtgcgccaac
attctgggctacgctgtgtccacctttgcgttcaccaaggcttacctgttccccacgaac
tccgaagactggtgagtgcaattcacggggaacttcgtctatgactttatgatgggcatc
gaattcaacccccgcgtcggcaagtggtttgacttcaagctgttcttcaacggtcgcccc
ggcatcgtggcctggacgctcatcaacctgtcctacatggccaagcagcaggagctctac
gggcacgtcacaaactccatgatcctcgtcaacgtgctgcaggccatttatgtgctggac
ttcttctggaacgaggcgtggtacctcaagaccatcgacatctgccacgaccactttgga
tggtatctgggctggggggactgtgtgtggctgccctacctctacacattacagggtctg
tacctggtctaccacccggtccagctgtccaaccttcacgctctggctgtgctcctgctc
ggcctggtgggatattacatcttccggtccaccaaccaccagaaggacctgttccggcgc
agcaacggctcctgcaccatctggggccgcaaacccacctttatcgagtgctcgtaccgc
tccggtgacggcgaggtccaccacagtaagctgctgacctcaggtttctggggagtggcg
cgccacttcaactacacgggcgacctgatgggatcgctggcctactgcgccgcctgtggc
ttcggacacctcctcccgtacttctacatcatctacatgaccatcctgctggtccaccgc
tgcgtacgcgacgagcaccgctgcagcagcaaatacggcaaagactggaagcgctacacc
gacgccgtgccgcaccggctgattcccgggatcttttag

DBGET integrated database retrieval system