KEGG   Takifugu rubripes (torafugu): 101071903Help
Entry
101071903         CDS       T02386                                 

Definition
CAD protein-like
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tru00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tru00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 2230 aa AA seqDB search
MASLILEDGTTFKGLLFGANASVSGEVVFQTGMVGYPEALTDPSYRCQLLTLTYPLVGNY
GVPKDEEGEFGLSKWFESSQIYAAALIIGELSENPSHWSSVKSLDQWLKEQGVPGLQGID
TRSLTKKIREKGTMLGKLVVDGTPEETVPFDNPDERNLVQEVSIKEPRVFNPSGGLRITV
VDCGIKYNQIRCLAQRGARVTVVPWDYPLDSAEFDGLFVSNGPGDPQLCQATINNLKKVV
CVEHPKPLFGICLGHQLLSLVIGSKTYKMKYGNRGHNQPCIHKGTDRCFITSQNHGFAVD
PASLPEDWDVLFTNANDHTNEGIIHNTKPLFSVQFHPEHKAGPTDLVSLFDVFLSTVKDH
KEGNVSKSVKQRLMDHLVYPDTLNPNEVVRPKKVLILGSGGLSIGQAGEFDYSGSQAIKA
LKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTAL
NCGVELTKQGILEKYKVTVLGTPVASIEMTEDRKIFVEKMEEINEHVAPSEAALSVEQAV
SAAERLGYPVLVRSAFALGGLGSGFANNSEELVTLVTSAFAHTSQVLVDKSLKGWKEIEY
EVVRDAYDNCVTVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGIV
GECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPQLKNSV
TNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRSFEEAFQKALR
MVDENCVGFDHTIKPVSEKELQTPTDKRIFVLAAAFRAGYTVDQLYELTKIDRWFLHKMK
NITDHERLLETYNQDESAMPAEVILKAKQLGFSDKQIALAVQSTELVVRKLRHERSILPV
VKQIDTVAAEWPAFTNYLYLTYHGTENDLHFNDQHVMVIGSGVYRIGSSVEFDWCAVGCI
TELRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYERENPDGIILSMGGQL
PNNIAMSLHRQQCRILGTSPEFIDSAENRFKFSRMLDTIGISQPQWKELSDTESAMKFCE
TVGYPCLVRPSYVLSGAAMNVAYGDSDLEKYLSSAVAVSKEHPVVISKFIQEAKEIDVDA
VACDGVVMAIAISEHVENAGVHSGDATLVTPPQDLNQKTMETIKMIVHAIGQELQVTGPF
NLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVAMATQAIMGEDVEPLGLMAGKGIV
GVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPKKNILLSI
GSYKNKSELLPTVQALESLGYDLYASLGTADFYTEHGVKVTAVDWPFEEDDNGCPTKEKQ
RSIMNYLEENHFDLVINLSMRNSGGRRLSSFVTKGYRTRRMAVDYSVPLIIDIKCTKLFV
QALHQIGSAPPVKTHIDSMTSQKLVRLPGLIDVHVHLREPGATHKEDFASGTAAALAGGV
TLVCAMPNTSPAITDPATLSQFQKLAKAGSRCDYALYVGAASDNAAILPSIASQAVGLKM
YLNDTYSTLKMDNVSLWMEHFEMWPKHMPIVAHAEKQTVAAILMVAQLYQRPVHICHVAK
KEEISIIRAAKQKGIQVTCEVAPHHLFLCEDNVVEIGNGRAQVRPMLGSREDMEALWENL
DIIDCFATDHAPHSVEEKNSNSPPPGYPGLETMLPLLLTAVSDGRLTLDDIIKRLYDNPR
RIFNLPVQENTYVEVDLEQEWVIPQAMQFTKSKWTPFQGLKVKGKVRRVVLRGEVAYIDG
QVLVPPGYGDDVKTWSSVPILPSEPVKETPRTPERPRPTPPRESLIRTRAPSPRREGRYL
LTPRIHRSSDPGLPPELLGISQAMVSGGDGYGHPPPLSRLLSPQSGPGPAAVLQASHFQM
SPLLHPLVGQHILTVRQFSKEQISHLFNVAHTLRLLVQKERSLDILKGKVMASMFYEVST
RTSSSFSAAMQRLGGSVVHFSESTSSSQKGESLADSVQTMSCYADVLVLRHPTPGAVESA
SRQCRKPVINAGDGVGEHPTQALLDVFTIREELGTVNGMTITMVGDLKHGRTVHSLAKLL
TQYRITLRYVAPKNLHMPAEIIDFVASKGIKQEEFDSIEEALPETDVLYMTRIQKERFAS
EEEYRACFGQFILTPHIMTVAKKKMVVMHPLPRVNEISVEVDTDPRAAYFRQAENGMYIR
MALLATVLGR
NT seq 6693 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtttgattctggaggacgggacgacttttaagggcctcctttttggtgcaaac
gcgtcggtgtccggagaagttgtgtttcagacgggcatggtgggctacccagaggctctg
actgacccatcctatcgctgccagctgctgaccctcacctacccactcgtgggcaactat
ggtgtaccaaaggatgaggagggggagtttggactgagcaagtggttcgagtcgtcccag
atctacgctgctgctctgatcattggagagctgtcagagaatcccagtcactggagttca
gtcaagtcgctggaccagtggctcaaagagcaaggtgttccgggattacaaggaatcgac
acacgcagtctgacaaaaaagatcagggagaaggggaccatgttggggaagctggtcgtg
gatggaacacctgaggagacagttccctttgataatccagatgagaggaacctggtccag
gaggtctcaattaaggagcccagagttttcaaccctagtggaggtttgaggatcacagtg
gtggactgtggcatcaagtacaaccagatccgctgcctggctcagaggggagcccgtgtt
accgtcgtaccctgggactacccgctggacagcgcagaatttgatggtctgttcgtcagt
aatggtcccggggacccccagctctgtcaggccaccatcaacaacctgaaaaaggtggtc
tgtgtggaacatccaaagcctctttttggtatttgtctgggacaccagctgctgtctttg
gtcatcggatccaagacctacaagatgaagtacgggaaccgtggccacaaccaaccgtgc
atacacaagggaacagatcgctgcttcatcaccagccaaaatcacggctttgctgtggac
cctgcctcactgccggaggactgggacgtcctcttcaccaacgccaacgaccacaccaac
gagggcatcatacacaacacaaaacccctgttcagcgttcagttccatccagaacacaag
gccggccccacagacctggtcagcctgtttgacgtcttcctcagcactgtaaaagaccac
aaggagggcaacgtttccaaatccgtgaagcagcgtctgatggaccacctcgtttacccg
gataccttgaaccctaatgaggtagtccgacccaaaaaggtcttaatcctgggctcagga
ggcctgtccattggccaggccggggaatttgactactctggctctcaggctattaaagct
ctcaaggaggagaacatccagacagtgctgatcaaccccaacatcgcaactgtccagact
tctaaggggctggctgacaaagtctatttcctgcctatcacaccagagtatgtcacccag
gtgataaagaatgagcgacctgacggtgtgttgctgaccttcggtggtcagacggccttg
aactgcggggtggagctcaccaagcaggggatcctggagaagtataaagtcacggttctg
gggacgccagtggcctccattgagatgaccgaagacaggaaaatctttgtggagaaaatg
gaagagatcaacgaacatgtggctcccagtgaagcagcactgtctgtggagcaggctgtc
tctgccgcagaacgtctgggctaccctgttctggtccgttcagcattcgctcttggagga
ctgggttcaggcttcgccaacaacagtgaggagcttgtcactttggtgacgtcagcgttt
gcacacacatcacaggtcctggtggacaaatcactcaaaggctggaaggagatcgagtat
gaggttgttcgagatgcctacgacaactgcgtcaccgtgtgtaacatggagaacatcgac
cctctgggaatccatacgggagaatccattgtggtggcgccgagtcaaacgctcaatgac
tatgaatataacatgctgaggaacacggccatcaaagtcattagacacctcggcattgtt
ggggagtgtaacatccaatatgctctgaacccagagtctgagcagtactacatcattgag
gtgaatgctcgcctatcgcgtagctcggccctggcgagcaaggccacgggttatccttta
gcctatgtcgcagctaaactgggtctgggcatcccactgccccagctgaagaactctgtg
accaactcgacaacagccaactttgagccgagtttggactactgtgtggtgaaggtgcct
cgctgggatctcagcaagttcctcagggtttccaccaagataggcagctccatgaagagt
gttggtgaggtgatggctatcggccgaagctttgaggaggccttccagaaagctctgagg
atggtggatgagaactgtgtcggcttcgatcacaccatcaaacctgtttctgaaaaggag
ttgcagacgccaacagataagcgcatctttgtcctggctgcagccttcagagctggttac
accgtggaccagctgtacgagctaactaagattgaccgctggttcctgcacaagatgaag
aacatcaccgaccacgagcgcttgctggagacttacaaccaggacgagagcgccatgcct
gcagaggtgatactcaaagccaagcagctcggcttctcggacaagcagatagcgctcgct
gtgcagagcactgagcttgtggtgagaaagctgcgtcatgaacggtccatcctgcccgtg
gtgaagcagatcgacacggtggccgccgagtggcctgccttcaccaactacctgtacctg
acataccacggtacagagaacgacctgcatttcaacgaccagcacgtgatggtgatcggc
tcaggcgtctaccgcatcggcagcagcgtggagtttgactggtgcgcagttggatgcatc
actgaactcaggaagatgggctataagaccatcatggtgaactataacccagaaactgtc
agtacagactacgacatgtgtgaccgtctctactttgacgaaatctcctttgaggtggtg
atggatatctacgagagggagaatccagatggaataatcctctctatgggaggccagctg
cccaacaacatagccatgtctctgcaccgccagcagtgccgcatcctgggaacctcgcca
gagttcatagacagtgctgagaacaggtttaagttctcccgcatgctcgacaccatcggg
atcagccaaccacagtggaaggagctctccgacactgaatctgccatgaagttttgtgag
actgtgggttatccatgcctggtccggccctcctacgttctcagtggtgcagccatgaac
gttgcctacggtgacagtgacctggaaaagtacctgagcagcgctgtggccgtgtccaaa
gaacacccggtcgtcatctcgaaattcatacaggaggccaaggagatcgatgtagatgcc
gtagcctgcgacggggtggtgatggccatcgcgatatcggagcatgtggagaatgccggc
gttcactcgggagacgccactttggtgacgccacctcaggacctcaaccagaagacgatg
gagacgatcaagatgatcgtccacgccattggtcaagagctgcaggttaccggaccgttt
aacctgcagctgattgcaaaggacgaccagctgaaggtgatcgagtgcaatgttcgagtc
tctcgctccttccccttcgtatcaaagaccctgggtgtggacctggtagctatggctact
caggccattatgggggaggatgttgagcccctgggcctcatggcaggaaaggggattgtt
ggagtcaaggttccccagttctccttctctagattggctggtgctgacgtggtgcttggt
gtagagatgaccagcactggggaggtggcctgctttggggagaacagatatgaggcatat
ctgaaagccatgctctctacaggcttcaagatccccaaaaagaacatcctgctctccatt
ggtagctataagaacaaaagtgagctgctgcccaccgttcaggccctggagtctctgggt
tatgacctgtacgccagtctgggaactgcagatttctacacggaacatggcgtcaaagtg
acagcagtcgattggccgtttgaggaggatgacaacgggtgtccgaccaaagagaagcaa
cgcagcatcatgaactatctggaagagaatcactttgatctggtcatcaacctgtccatg
aggaacagcggaggtcggaggctctcctcgttcgtcaccaaaggttacaggacgaggcgc
atggcggtggactactctgtcccgctcatcattgatattaaatgcaccaagctctttgtt
caggctctccatcagatcggcagtgctccaccagtcaagactcacattgacagcatgacg
tctcagaagctggtccgtctgcctggtctgatcgacgtgcacgtgcacctgcgggagcct
ggagccacacataaggaggacttcgcctctggtacagcagcagctctggctggaggagtg
accctggtgtgcgccatgcccaacacgtcccccgccatcactgaccccgccaccctgtct
cagtttcagaagttggccaaagcaggcagtcgatgcgactacgccttgtatgtgggtgcc
gcctccgacaatgccgccatcctgccgtccatcgccagccaggctgttggcctgaagatg
tacctgaatgacacgtactccaccctgaaaatggacaacgtgtctctgtggatggagcac
tttgagatgtggcccaagcacatgcccattgtcgctcacgccgagaagcagacggtcgct
gccatcctcatggtggctcagctctaccagcggccagtccacatctgccatgtggccaag
aaggaggagatttcaatcatccgagcggcaaagcagaaaggcatccaggtcacatgcgag
gtggcgcctcatcacctcttcctctgcgaggataatgtggtggaaattggcaacgggcga
gcacaagtgcggcccatgctgggctcacgcgaggacatggaggcgctttgggaaaacctc
gacatcatcgactgcttcgccactgaccacgctccccactctgtggaagagaagaacagc
aacagtccacctccaggttaccctggcctggagaccatgctgccactgctcctgaccgct
gtcagcgacgggcgtctcaccctggacgatatcatcaaacgtctgtacgataacccacgc
aggattttcaacttacctgtccaagaaaacacttacgtggaggtggacctggaacaggag
tgggtgatccctcaggccatgcagttcaccaagtcaaagtggacacctttccaggggctg
aaggtgaagggaaaggtccgccgcgtggttctgcgtggagaggtggcctacatcgatggc
caggtgttggtacctccaggttatggtgacgacgtgaagacgtggtcatccgtgccgatt
cttccttctgaacctgtcaaagaaactcccagaactccagaacgccctcgcccgactcct
cccagagaaagcttgatccggacgagagctcccagccctcgacgggagggtcgctacctg
ctgacgcctcgcatccaccgctcctctgatccaggacttcctccagagctgcttggaatt
tcccaggcgatggtcagcggtggcgatgggtacggtcaccctcctcctctgtccaggctg
ttgtccccacagtcaggaccaggacctgctgctgttttgcaggcatcccactttcagatg
tcccctctgctgcacccactggttggccagcacatcctgacagtcaggcagttcagcaaa
gaacagatctcgcacctcttcaatgttgctcacactctgcgtttgctggttcagaaggag
cggagcctggacatcctgaagggtaaggtgatggcttccatgttctatgaggtcagcact
cgcaccagtagctccttttcagcagccatgcagcgactgggaggctcggtggttcacttt
agtgaatccacttcttcctcgcaaaaaggagaatctctggctgactctgtccagaccatg
agctgctacgccgacgtcctggtgctccgacacccaacgccaggagctgtagagagtgcc
tcacgtcagtgtcgtaaaccggtgatcaatgctggggatggcgttggggagcacccaacc
caggcgctgctggatgtcttcaccatcagggaagagctggggacggtcaacggaatgact
ataactatggtgggagatctgaaacacggccgtactgtccactccctcgccaaactgctc
acacagtaccgcatcacgctgcgctacgtggctcccaaaaacctccatatgccagcagaa
attattgacttcgtggcttcaaagggcattaaacaggaagagtttgacagcatcgaggag
gcactgcctgagaccgatgtgctctacatgacaagaatccagaaggagaggtttgcatct
gaggaagagtacagggcttgttttggtcagttcatcctgactcctcatattatgactgtt
gctaagaaaaagatggtggtgatgcatccactgcccagagtcaatgaaatcagtgtggaa
gtggacacagacccgagggcggcttacttccgtcaggcagaaaatgggatgtatatccgt
atggccctacttgccaccgttctgggcagatag

DBGET integrated database retrieval system