KEGG   Takifugu rubripes (torafugu): 101071937Help
Entry
101071937         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 506 aa AA seqDB search
MSPAGCPHVNSFKVDNWKQNLRVIYQCFVWSGSAETRKRKAKSCICHMCGAHLNRLHSCL
HCVFFACFAKKHIHEHAKSKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQIAKDEQRKAWK
MQGIGEKYSTWEPTKRELELLRHNPKRRRITSNCTIGLRGLINLGNTCFMNCIVQALTHT
PLLRDFFLSDRHKCQMQSDSCLVCEMSQLFQEFYSGHRSPHIPFRLLHLVWTHARHLAGY
EQQDAHEFLIAALDVLHRHCKDDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVST
TIDPFWDISLDLPGSSTPFWPLSPGGDSSALNGESHATGATTLTDCLRRFTRPEHLGSSA
KIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMA
SSKESRMNGQCQQIVDPFNNDNKYSLFAVVNHQGTLESGHYTTFIRQHKDQWFKCDDAII
TKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgcgggctgccctcatgtcaacagcttcaaagtggacaactggaagcaaaac
ctgagggttatttatcagtgtttcgtgtggagcggttcggccgagaccagaaaacgcaag
gccaagtcatgtatctgccacatgtgcggcgcccacctcaacagacttcactcctgcctt
cactgcgtcttcttcgcctgctttgccaaaaaacacatccacgagcatgccaagagcaaa
agacataatctcgctattgacctgctgtacggagggatctactgttttatgtgccaagac
tacatttacgacaaagacatggaacaaatcgccaaagacgagcagagaaaggcatggaaa
atgcaaggcataggggagaagtactcaacgtgggagcctaccaaaagggagctcgagctg
cttcgacataaccccaagaggaggagaatcacctccaactgtactattggcctgcgaggt
ctgatcaacctgggcaacacgtgctttatgaactgtatcgtccaggcgctgacacacaca
cccttgctccgtgactttttcctgtctgaccggcacaagtgtcagatgcagagcgactcc
tgtttggtgtgcgagatgtcgcagcttttccaggagttctactcaggccaccggtccccg
cacatccccttcagactcctccatctggtgtggactcatgctcgtcacctggctggatac
gagcagcaggatgctcacgagtttctaatcgcagctcttgatgtcctgcacagacactgc
aaagatgataatgggaaaaaggccaacaatcccaaccactgcaactgcatcattgaccaa
atcttcacaggggggctgcagtctgacgtcacctgtcaagtgtgccatggtgtttcaaca
acaatagaccctttctgggacattagtctagacctgccaggctcctccacccccttctgg
cctctaagccccgggggagactcttcagcccttaatggagagagccacgccacaggagcc
acgacactcaccgactgtctgcgcaggtttactagacctgagcacctcggcagtagtgct
aagatcaaatgcagtggttgccatagttaccaggaatccacaaaacagctgaccatgaag
aagctgcccatcgtagcttgttttcaccttaaaaggtttgaacattcagccaaactgcgg
cggaagatcacaacttatgtctccttccccctggagctggacatgacacccttcatggcc
tctagtaaggaaagtcggatgaatggacagtgccaacaaattgtggaccccttcaacaat
gacaacaagtacagtctgtttgcagtggtgaaccaccaggggacactagagagcggccat
tacaccactttcatccggcagcacaaggaccagtggttcaaatgtgacgatgccatcatc
accaaggccagcatcaaggatgtcttggacagtgaagggtacctattgttttaccacaaa
cagttcctggagtatgagtag

DBGET integrated database retrieval system