KEGG   Takifugu rubripes (torafugu): 101072042Help
Entry
101072042         CDS       T02386                                 

Definition
probable histone deacetylase 1-B-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cell cycle
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:tru04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:tru04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 474 aa AA seqDB search
MALSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRRMEIYRPHKAS
GEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAG
AVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMAKVMEMYQPSAIVLQCGADSLSGDRLGCFNLTIKGHGKCVEYMKSFNLPLLMLGG
GGYTIRNVARCWTYETAVALDCSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAPHPDSGDEDEEDPDKHVSIRAHDKRIACDEEF
SDSEDEAEGQGGGRRNSANHKKVKRVKKEEEKEGEEKKEVKEEEKEEEKMDTSG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtctcaaggaacaaagaaaaaagtttgctattactatgacggtgatgtgggg
aactactactatggccagggccatcctatgaaaccccacaggatccgcatgacgcacaac
ctcctcctcaactatggactttacaggagaatggagatctacaggccacacaaagctagc
ggggaagagatgaccaagtaccacagtgacgactacattaagttcctgagatccatccgt
ccagacaacatgtctgagtacagcaaacagatgcagagattcaatgttggtgaagactgt
ccggtgtttgatggtctgtttgagttttgccagctgtcaacgggcggctccgtcgctggc
gcggtgaaattgaacaagcagcagacagacatcgccatcaactgggccggcggtctccat
cacgccaagaagtcggaagcctcgggcttctgctacgtcaatgacatcgtcctggccatc
ctggagcttctcaagtaccaccagagggtgttgtacatcgacattgacatccaccacggt
gacggggtggaggaggccttctacaccacagacagagtcatgactgtttcctttcacaag
tacggggaatacttccccggaaccggagacctgagggacatcggggccgggaagggcaag
tattatgctgtgaactacccgctcagggacggcattgacgacgagtcctatgaagccatc
ttcaaacctgtcatggctaaagtcatggagatgtaccagccaagtgcaatcgtgctccag
tgtggagctgactctctctccggagaccgactgggctgcttcaacctcaccattaaaggt
cacggcaaatgtgtcgagtacatgaaaagtttcaacctgcccctgctgatgctcggaggc
ggaggctacaccatccgcaacgtggcccgctgctggacgtacgagaccgccgtggccttg
gactgctccatccccaacgagctgccctacaacgattacttcgagtacttcgggcccgac
ttcaagctgcacatcagcccgtccaacatgaccaaccagaacaccaacgaatacctggag
aagatcaagcagcgcctgttcgaaaacctgcgcatgttgccccacgcgccaggcgtgcag
atgcaggccatcccagaggacgccccccaccccgacagcggggacgaggacgaggaggac
cccgacaaacacgtctccatccgagcccacgacaagaggatagcttgcgacgaggagttc
tccgactcggaggacgaggcagagggacaaggaggggggcgcaggaattctgctaaccac
aagaaggtgaagagagtgaagaaggaggaagagaaagaaggagaggagaagaaagaagtg
aaagaggaggaaaaagaggaagagaagatggacacttcagggtaa

DBGET integrated database retrieval system