KEGG   Takifugu rubripes (torafugu): 101072145Help
Entry
101072145         CDS       T02386                                 

Definition
glutathione S-transferase kappa 1-like
Orthology
K13299  
glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Peroxisome
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tru00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:tru00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:tru00982]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:tru04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 228 aa AA seqDB search
MTSKKVIELFYDVVSPYSWLGFEVMCRYRHVWNIELKLCPAFLGGVMQGSGNKPPGVVPN
KFMYMTKDLKRAAEYFDVPLQAPADPFEVMFKKGSLSAMRFVTAVQEQEKGGDKLVEQVS
RELWRRIWSEDKDITEAASLAEAAKKAGLSDGVIKDALETAASKEIKDKLKDATQKALDY
GAFGFPLLVYHRNGSPEIFFGSDRFELLAHCIGEKWLGPRPNNSAAKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaagaaagtcatcgagttgttctacgacgtggtgtctccgtactcctggctg
ggctttgaggtcatgtgccgttacagacacgtgtggaacatagaactcaaactgtgtcct
gcgttccttggtggcgtcatgcaaggatcaggaaacaagccccctggtgtggttccaaac
aaattcatgtacatgaccaaggacctgaagcgtgcagcagagtattttgatgttcctttg
caagctcctgctgatccctttgaggtcatgttcaaaaaaggctctctgtcggcgatgcgc
tttgtgacagcggtgcaagaacaggagaaaggaggagacaagctggtggagcaggtgtcc
cgggagctgtggagacggatctggagcgaggacaaggacatcactgaagccgcatcgttg
gcggaggcagccaagaaagcgggattgtctgacggcgtgatcaaagatgcgctggagacg
gccgcctccaaggagatcaaagacaagctgaaagacgccacacagaaggctctggactac
ggggcctttggcttccccctgttggtgtaccaccggaacggaagccccgagatctttttt
ggatcggacagatttgagctgttggctcactgcatcggggagaagtggttgggacctcgg
cccaacaactcagctgccaaactgtga

DBGET integrated database retrieval system