KEGG   Takifugu rubripes (torafugu): 101072178Help
Entry
101072178         CDS       T02386                                 

Definition
lysosomal thioesterase PPT2-A-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101072178
  Lipid metabolism
   00062 Fatty acid elongation
    101072178
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101072178
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     101072178
Lipid biosynthesis proteins [BR:tru01004]
 Fatty acid synthase
  Component type
   101072178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 303 aa AA seqDB search
MQDFCPRTRTRRSSSSRVSALLYPLLGACFWASVAGYKPVIIVHGLFDSSEDFKNLKMFI
NQSHPGTNVTVIDLFDRSASLEPMWKQVEGFKAAIYPIMQNAADGVHFICYSQGGLVCRG
ILSTLSEHNVNSFISLSSPQAGQYGDTDYLKYLFPQFVKSNLYHLCYTGVGQRISICNYW
NDPHHRDLYVNSSDYLALLNSERANPNATEWKKNFLKIKKLVLIGGPDDGVITPWQSSQF
GFYDNNETVIEMQEQDLFLRDVFGLKTLAARGDLIICSVPGVQHVFWHSNETVFHTCMEK
WLE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacttttgtccgaggacaagaaccagaaggtcgagcagcagccgggtctctgcc
ttgctgtacccgctgctcggtgcgtgtttctgggcttcggtggctggatacaagccggtg
ataatagtgcacggtttgttcgacagctctgaggattttaaaaacttaaagatgttcatc
aaccaatctcatcctggcaccaatgtgacggtcatcgacttgtttgacaggagcgccagc
ctggagcccatgtggaagcaagtggagggattcaaggcagctatttacccaataatgcaa
aacgcagcagatggggtccattttatctgctactctcaaggaggcctcgtctgcagagga
atcctgtccaccctctcagaacacaacgtcaattctttcatctctctgtcctccccccag
gctggtcagtatggagacacagactatctgaagtacctgttcccacagtttgtcaagtcc
aacctctaccacctgtgttacactggagtaggtcagaggatatccatctgcaactactgg
aacgaccctcatcacagagacctgtacgtgaacagcagtgattatttggctcttctgaac
agcgaaagagccaatccaaatgcaacagagtggaagaaaaacttcctcaagatcaagaaa
ctggtgttgataggtggtcctgatgacggcgtgataacgccctggcagtcaagccagttt
gggttttatgacaacaacgagaccgtcatagagatgcaggaacaagacttgtttttgaga
gatgttttcggtttgaagacgctggcggctcgtggggatctaatcatctgttctgttcct
ggggtccagcacgtgttctggcactcgaatgagacagtgtttcacacgtgcatggagaag
tggctggaataa

DBGET integrated database retrieval system