KEGG   Takifugu rubripes (torafugu): 101072184Help
Entry
101072184         CDS       T02386                                 

Gene name
usp28
Definition
(RefSeq) ubiquitin specific peptidase 28
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101072184 (usp28)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101072184 (usp28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1202 aa AA seqDB search
MKEKGEHGQKAAATGDLVINQLREITGIQDPQVLHSALNASQGDVGLAVGLLTSQPPEVQ
DPGDPQESKTSDETWESQKEVKVNSGLPEDELQTAIELSLQESHNAQQEEKDLNRVLEAS
AEENLARIKRVKRSEGQTDMSSPADWIRQDDWPVGIRNVGNTCWFSAVIQSLFHLPVFRR
LVLNYRLSERILEKCKSHSDKRNIAFMQELRCLFALMVGSTRRFVDPSAAVELLRDAFRT
SEAQQDVSEFSHKLLDWLEDAFQLAANGSDAADKQQNPMVQLFYGTFVTERKIDGKTLCN
IEQFGQYPLQVNGFNNLYECLEGAMVEKEIESLHSDHSIPSGRERWFKKLPPVLTFELSR
FEFNTQLGRPEKIHKKLEFPPIIHMDRYLHKNIEQMHERRRDVKKLKDQLAALQQELECY
RNYGSGPTKYPLADMLQFVLEFATTKPINLTAAEDPRPSSPSPSQPGQPVGEATSQDTRD
TEPPEGLVSSCQRTPIYKPFTQCRPPIECPPHPAPHSITDEELHFVKTCLQRWRAEVEND
INELKANIDRLSQMLESMYSDNRLCQVPYRLHAVLVHEGQASAGHYWAYIYDHANQRWMK
YNDINISESSWEELERDSFGGMTNASAYCLMYIDDRLPNLITDDTDDETGQVLHGLDSLP
SVLRRYVSEDNRWFQQELSEWEEQICQTASPQGESTSSAEPPAPCPDHLPQTVVEPAPQS
GPPSEEPEQRPSSEPHPEPEPEQEMGDNLEHEDKQKEYTELTLPAPPKHSPSPQPDDDGS
AAAVQSSQRSADVELHSQDPGDETQPKNPTPSDLHEEANVKEVLADHSHEADHHPEEPGE
AAPHQEQNQEEPQDGQEGQVRQRHTENEVSEVDIPNVGRITVRADADGYNEEMMLTPAMQ
GVILAIAKARQTFDTEGPEAGLIKAFHEEYSRLYELSLEETSPQEDARLQHVLVYFFQNK
APKRIVERTLLEQFTDRNLSFDERSISIMREARSKLRLIKPEDMDMDEYLQWHDDYKLFR
TVFVYLLTGLEHYQNRKMREALTYLTHAYEINTTLLKKGEKFAVEQTVITLFRRKCLTAL
NESATQLFCSGTEASVDEGVAIMDEVVIPCLHLMSRDPALSQEDQEAMERVRSHWCSCLS
RSMDDLLQVKLGEFLPRVLDSSADAVVLKDPPQVHVNQAYDLCSRLAAVMESIHKSSVVA
VK
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaagggcgaacatggacaaaaggcggcggccacgggtgacctggtgatcaac
caactgagggagatcactggaatccaggatccacaggttctccacagtgccctgaatgcc
agtcagggggacgtgggacttgctgtagggctgctgaccagccagcctccagaagttcag
gatccaggagatccacaagagtctaaaacctctgatgagacctgggagagccagaaagaa
gttaaagttaattcaggacttcctgaagacgagctgcagacagcgattgagctcagcctg
caggaatcccacaatgctcagcaggaggagaaagacctcaacagggttttggaggccagt
gcagaggagaatctagcccggatcaagagggtgaagaggagtgaaggtcagactgacatg
agtagccccgcagactggatccgccaggacgactggcccgtcggcatccgtaatgtgggg
aacacgtgctggttcagcgccgtcattcagtctttgttccacctgcccgtcttcaggagg
ttggttctcaactaccgtctgtctgagcgaattctggagaagtgcaagagtcattctgac
aagaggaatatcgccttcatgcaagagctgcgctgcctgttcgccctcatggttggttct
acccgcaggtttgtggatccctcagctgctgtggagttactgagggatgccttcaggacc
agcgaggcccaacaggatgtgagtgagttttcccacaaacttctggactggctggaggac
gcatttcagctggctgccaatggaagtgatgctgcagacaaacagcagaatcccatggtc
cagctgttctacggtacctttgtcacggagagaaaaatcgatggtaaaacattgtgtaac
atcgagcagtttggtcagtaccccctgcaggtgaacgggttcaacaacctttacgaatgc
ctggaaggtgccatggttgagaaggagatcgagtccctgcattcagatcacagcatcccg
tcaggccgcgagagatggttcaagaaattaccgccagtgttgacctttgaactgtcgagg
tttgaattcaacactcagctcggtcgtcctgagaagatccacaaaaagctggagttccca
ccgatcatccacatggaccgatatcttcacaaaaacatcgaacagatgcacgagaggaga
agagacgtgaagaaactcaaggatcagctcgcagcacttcaacaggaacttgaatgctac
aggaactacggctcaggccccaccaaataccctcttgcagacatgttacagtttgttctg
gagttcgccaccactaaacctataaacctaactgcggctgaagatccgagaccgtcttca
ccctcaccatctcagcccggtcaacccgtgggtgaagccacttcccaagacaccagagac
acagaaccaccagaaggcctggtgtccagctgccagagaacccctatttacaagcccttc
acccagtgccgaccacccatcgagtgcccaccacatccagctccgcacagcatcactgat
gaggagctgcatttcgtgaagacctgtctacagcggtggagggctgaggttgagaatgat
attaatgagttaaaggctaacatcgacaggctcagccagatgctggagagcatgtactca
gacaacagactttgtcaggttccctacagactccacgctgtgctcgttcatgaaggccag
gcttcagcggggcattactgggcctacatctatgaccatgcaaaccagcgctggatgaag
tacaatgacattaacattagcgagtcgtcatgggaggagcttgagcgagactcctttgga
ggaatgaccaatgccagtgcatactgtctgatgtatatagatgacagacttccaaacctc
attacagatgacacagatgatgagacgggtcaggttctgcatggactggactccttgccg
tcggtcctcagacggtacgtcagtgaagataaccgctggttccagcaggagctcagtgaa
tgggaggagcagatctgccagacggcatcacctcagggggagtctacatcttctgcagag
ccccctgccccctgtccagaccacctaccacaaacagtggtagaaccagcaccgcaatcg
gggcccccctctgaagaaccagagcagagaccttcttcagagccacatccagaaccagaa
ccagaacaagaaatgggggacaacttggagcacgaagacaagcaaaaagagtatacagag
ttaactcttccagcacctccaaaacacagccccagccctcagcccgatgacgacggcagc
gcggcagccgtgcagtccagccagaggtcagctgatgtggaacttcactctcaggatcct
ggtgatgaaacacagcccaaaaatccgacaccgtctgacctccatgaggaggccaatgtc
aaagaggttttggccgaccacagtcatgaagctgaccaccatccagaggagcctggagaa
gctgcgccacatcaagaacaaaaccaggaggagccgcaggatgggcaggaggggcaggtc
aggcagcgacacactgaaaacgaggtgtctgaagtggacataccgaatgtgggccggatc
accgtgcgagctgacgctgatggttacaatgaagagatgatgctaactccagccatgcag
ggtgttattctggccatcgctaaggccagacagacttttgacaccgagggtccagaagcg
ggactcatcaaggctttccacgaggagtactcacgcttgtacgagctctccctggaggag
acatctccgcaggaggacgctcgtctgcaacacgtcctggtttacttcttccagaacaag
gcacctaaacgcatcgttgagaggactcttctggaacagttcacagaccgtaacctgagc
tttgatgagaggtccatcagcatcatgagggaggctcgatcaaaactacgtctgatcaaa
cccgaagacatggacatggatgaatacctgcagtggcacgatgactacaaactcttcaga
accgtgtttgtctacctgctgactggactggaacactaccagaaccggaagatgcgtgag
gcgctgacatacctgactcatgcgtatgagatcaacaccaccctcttaaagaaaggggag
aaatttgctgttgagcagactgtcatcacactctttaggaggaaatgtctcacggcattg
aatgagagcgcgacacagctgttctgcagtggcacggaagccagcgtggacgaaggtgtc
gccatcatggatgaggtcgttattccctgcctccacctgatgagtagggatccggctctt
tcccaggaggatcaggaggccatggaaagggtccgcagccactggtgctcctgtctaagc
cgcagcatggacgatttgttacaggtgaagttgggcgagtttctccccagagttctggat
agttctgctgatgctgtggttctgaaagaccctcctcaagtccatgtgaatcaggcctac
gacctgtgcagccgcctggctgccgtcatggagtccattcacaagtcgtctgtcgtggcg
gtcaagtaa

DBGET integrated database retrieval system