KEGG   Takifugu rubripes (torafugu): 101072192Help
Entry
101072192         CDS       T02386                                 

Gene name
usp46
Definition
(RefSeq) ubiquitin specific peptidase 46
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101072192 (usp46)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101072192 (usp46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 369 aa AA seqDB search
MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFR
ENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQD
AHEFLNYLLNTVADILQEEKKQEKQNGRLKNNGTAGATEAETDNKTESTWVHDIFQGTLT
NETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEYKYYCETCCSKQE
AQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDAVNLDRMYD
LVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESG
YILFYQSRE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagaaacatcgcctccatttgtaatatgggcaccaatgcctcggctctggag
aaagacatcggcccggagcaattcccaatcaatgagcactactttgggttggtcaatttt
ggaaacacctgctactgtaactcggtgctccaggccctctacttctgccggcctttccgg
gagaacgtgctggcgtacaaagcccagcagaagaagaaggagaacctgctcacctgcctg
gctgacctcttccactccatcgccacccagaagaagaaagtgggggtgatcccgcccaag
aagttcatctcccgcctgcgcaaagaaaacgatctctttgacaactacatgcagcaggac
gcccacgagttcctcaactacctgctgaacacggtggccgacatcctgcaggaggagaag
aagcaggagaagcagaacggccgtctgaagaacaacggcaccgccggcgccaccgaggcc
gagacggacaacaagacggagtccacgtgggtgcacgatatcttccagggcaccctgacc
aatgagacgcgctgcctcaactgtgagacggtgagcagcaaagatgaagattttctggat
ctttctgtggacgtggagcagaacacatcgataacacactgtctcagggacttcagtaac
acggagacgctgtgcagcgaatataaatactactgcgagacctgctgcagcaagcaggaa
gcacagaagcggatgcgtgtaaagaagcttcccatgatcctggcactacacctgaagagg
ttcaagtacatggagcagctgcatcgctacaccaagctctcctaccgcgtggttttcccg
ctggagctccggctgttcaacacatcgggagacgccgtcaatctggaccgcatgtacgac
ctggtggccgtggtggttcactgcggcagcggtcccaacagaggacattacatcaccata
gtgaagagtcacggcttctggctgctgttcgacgacgacatcgtcgagaaaatcgacgcc
caggccatcgaggagttctacggactcacgtctgacatctccaagaactccgagtccgga
tacatcctcttctaccagtcccgggagtga

DBGET integrated database retrieval system