KEGG   Takifugu rubripes (torafugu): 101072241Help
Entry
101072241         CDS       T02386                                 

Gene name
kat2a
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101072241 (kat2a)
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101072241 (kat2a)
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101072241 (kat2a)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101072241 (kat2a)
   HAT complexes
    PCAF complex
     101072241 (kat2a)
    STAGA complex
     101072241 (kat2a)
    TFTC complex
     101072241 (kat2a)
    SAGA complex
     101072241 (kat2a)
    SLIK complex
     101072241 (kat2a)
    ADA-HAT complex
     101072241 (kat2a)
    HAT-A2 complex
     101072241 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 797 aa AA seqDB search
MSDPAAQALQPRLLQAQTGGSAGSSTGNTGSGSGNSDPARPGLSQQQRASQKKAQVRAFP
RAKKLEKLGVFSACKAIDTCKCNGWKNPNPPSAPRMDLQQQAASLSESCRSCEHSLADHV
SHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKSILQMSQPVVE
GSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYRQ
RTQKDDGTAYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRSLLKSIFIVTRRQLLEKFR
VEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPASDGTQLGHQTVISPA
AVSGSPALPKGLSGVSAVGNVESGGAEPHTGEKRKISEALTLEDAKRIRVMGDIPMELVN
EVMMTITDPAAMLGPETNLLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWL
VGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCA
VTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLG
YIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPGLTCFKEGV
RQIPVESIPGIRETGWKPSNKDKGKEVKDPDVLYNMLKNLLAQIKSHPDAWPFMEPVKKS
EAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIISNCREYNHPDSEYCKCANT
LEKFFYFKLKDGGLIEK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacccggcagcgcaggccttgcaaccccggcttcttcaagcccagaccggtggc
tcagctggctccagcaccggtaatacaggttctgggtcggggaacagtgacccagcccga
ccgggactaagccagcaacagcgtgcaagccaaaagaaagctcaagtccgagctttccca
cgggcgaaaaagctcgagaaacttggcgtattctctgcttgcaaggcaattgacacctgc
aagtgcaatggatggaaaaatccgaatcctccatctgccccacgtatggatctgcagcag
caagccgccagcctgagcgagtcgtgccgcagctgtgaacattctctggctgaccatgtg
tctcacttggagaatgtctcagaggatgagatcaacaggcttttggggatggttgtggat
gtggagaatctttttatgtccgtgcacaaagaggaagacaccgacaccaaacaagtttac
ttttacctgtttaagcttttaagaaaaagtatccttcagatgagccagcctgtggtagaa
ggttctctaggaagtccaccttttgagaagcccaacattgaacagggagttttgaatttt
gtccagtacaagttcagccacctagcgccaaaggaaaggcagaccatgtttgagctgtca
aagatgttcctgttgtgcctgaactactggaaactggagacaccgacgcagtatcgccag
cgcacacagaaggacgatggaacagcctacaaagtggactacaccaggtggctgtgctac
tgccacgtcccccagagtaacgacagcctgccacgttatgaaaccactcaagtgttcggc
cgcagtttgctcaagtccatcttcattgtgacgcggcgtcagctcctggagaagttcaga
gtggaaaaggacaaactgttgccagagaaacgcacactcatcctcacacactttcccaag
tttttgtccatgctggaagaagaaatctatggtgaaaactccccaatctgggaagcagat
ttcaccgtgccagcttcagacgggacacaactggggcatcagacggtgatcagccccgcc
gctgtgtccggctctcctgctttgcccaagggtctgagtggcgtgtcggctgtagggaat
gtggagagcggcggcgccgagccccatacgggagagaagcgtaaaatttcggaggccttg
accctggaggatgccaagcgaatccgtgtgatgggagacatcccgatggagctggttaac
gaagtgatgatgacgattaccgaccccgccgccatgctcgggccagagacgaacctgctg
acgccaaacgccgcacgcgacgagacggcccggctggaggaaaggcggggcatcatcgag
tttcacgtcattgggaactcgctttcccaaaagtccaataagaagatcctgatgtggttg
gttggtctacagaacgtgttctctcaccagttacctcgcatgcctaaagagtacatcacc
cggctggtctttgacccaaagcacaagaccctcgccctcatcaaagatggacgcgtcatc
ggcggcatctgcttcaggatgtttccaactcagggcttcacagagatcgtcttctgtgcc
gtcacgtccaacgagcaggtcaagggctacggaacccacctgatgaaccacctgaaggag
tatcacatcaaacacaacatcctctatttcctcacctacgctgacgagtatgccattggc
tacttcaagaagcagggtttttccaaagacatcaaagtgccgaaaagccgctacctggga
tacatcaaagattacgagggggcgacgctgatggagtgtgagctgaacccgaggatcccc
tacaccgagctctcgcacatcatcaaaagacagaaggagattataaagaagctgattgag
aggaaacagagccagatcaggaaggtttacccaggactcacctgcttcaaagagggtgtg
cgacagatcccggtggagagcattccaggcatacgggaaacaggctggaagcccagcaac
aaggacaaagggaaagaggtgaaggatccagatgtgctgtacaacatgctgaagaacctt
ctggcccagataaagagtcatcctgatgcctggcccttcatggaacctgtgaagaaatcc
gaggctccagattactacgagatcatccgctttcctatcgacctgaagaccatgacggaa
cgactgaagaacagatactacgtgaccaagaaacttttcattgccgacctgcagcgaatc
atctctaactgtcgtgagtacaaccacccagacagcgagtactgcaagtgtgccaacacc
ttggagaagttcttctacttcaaactaaaagacggaggcctgatcgagaaatga

DBGET integrated database retrieval system